Cargando…

Molecular Analysis of Anisakis Type I Larvae in Marine Fish from Three Different Sea Areas in Korea

Anisakiasis, a human infection of Anisakis L3 larvae, is one of the common foodborne parasitic diseases in Korea. Studies on the identification of anisakid larvae have been performed in the country, but most of them have been focused on morphological identification of the larvae. In this study, we a...

Descripción completa

Detalles Bibliográficos
Autores principales: Sohn, Woon-Mok, Kang, Jung-Mi, Na, Byoung-Kuk
Formato: Online Artículo Texto
Lenguaje:English
Publicado: The Korean Society for Parasitology and Tropical Medicine 2014
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4170034/
https://www.ncbi.nlm.nih.gov/pubmed/25246717
http://dx.doi.org/10.3347/kjp.2014.52.4.383
_version_ 1782335782247202816
author Sohn, Woon-Mok
Kang, Jung-Mi
Na, Byoung-Kuk
author_facet Sohn, Woon-Mok
Kang, Jung-Mi
Na, Byoung-Kuk
author_sort Sohn, Woon-Mok
collection PubMed
description Anisakiasis, a human infection of Anisakis L3 larvae, is one of the common foodborne parasitic diseases in Korea. Studies on the identification of anisakid larvae have been performed in the country, but most of them have been focused on morphological identification of the larvae. In this study, we analyzed the molecular characteristics of 174 Anisakis type I larvae collected from 10 species of fish caught in 3 different sea areas in Korea. PCR-RFLP and sequence analyses of rDNA ITS and mtDNA cox1 revealed that the larvae showed interesting distribution patterns depending on fish species and geographical locations. Anisakis pegreffii was predominant in fish from the Yellow Sea and the South Sea. Meanwhile, both A. pegreffii and A. simplex sensu stricto (A. simplex s.str.) larvae were identified in fish from the East Sea, depending on fish species infected. These results suggested that A. pegreffii was primarily distributed in a diverse species of fish in 3 sea areas around Korea, but A. simplex s.str. was dominantly identified in Oncorhynchus spp. in the East Sea.
format Online
Article
Text
id pubmed-4170034
institution National Center for Biotechnology Information
language English
publishDate 2014
publisher The Korean Society for Parasitology and Tropical Medicine
record_format MEDLINE/PubMed
spelling pubmed-41700342014-09-22 Molecular Analysis of Anisakis Type I Larvae in Marine Fish from Three Different Sea Areas in Korea Sohn, Woon-Mok Kang, Jung-Mi Na, Byoung-Kuk Korean J Parasitol Original Article Anisakiasis, a human infection of Anisakis L3 larvae, is one of the common foodborne parasitic diseases in Korea. Studies on the identification of anisakid larvae have been performed in the country, but most of them have been focused on morphological identification of the larvae. In this study, we analyzed the molecular characteristics of 174 Anisakis type I larvae collected from 10 species of fish caught in 3 different sea areas in Korea. PCR-RFLP and sequence analyses of rDNA ITS and mtDNA cox1 revealed that the larvae showed interesting distribution patterns depending on fish species and geographical locations. Anisakis pegreffii was predominant in fish from the Yellow Sea and the South Sea. Meanwhile, both A. pegreffii and A. simplex sensu stricto (A. simplex s.str.) larvae were identified in fish from the East Sea, depending on fish species infected. These results suggested that A. pegreffii was primarily distributed in a diverse species of fish in 3 sea areas around Korea, but A. simplex s.str. was dominantly identified in Oncorhynchus spp. in the East Sea. The Korean Society for Parasitology and Tropical Medicine 2014-08 2014-08-29 /pmc/articles/PMC4170034/ /pubmed/25246717 http://dx.doi.org/10.3347/kjp.2014.52.4.383 Text en © 2014, Korean Society for Parasitology and Tropical Medicine http://creativecommons.org/licenses/by-nc/3.0/ This is an Open Access article distributed under the terms of the Creative Commons Attribution Non-Commercial License (http://creativecommons.org/licenses/by-nc/3.0/) which permits unrestricted non-commercial use, distribution, and reproduction in any medium, provided the original work is properly cited.
spellingShingle Original Article
Sohn, Woon-Mok
Kang, Jung-Mi
Na, Byoung-Kuk
Molecular Analysis of Anisakis Type I Larvae in Marine Fish from Three Different Sea Areas in Korea
title Molecular Analysis of Anisakis Type I Larvae in Marine Fish from Three Different Sea Areas in Korea
title_full Molecular Analysis of Anisakis Type I Larvae in Marine Fish from Three Different Sea Areas in Korea
title_fullStr Molecular Analysis of Anisakis Type I Larvae in Marine Fish from Three Different Sea Areas in Korea
title_full_unstemmed Molecular Analysis of Anisakis Type I Larvae in Marine Fish from Three Different Sea Areas in Korea
title_short Molecular Analysis of Anisakis Type I Larvae in Marine Fish from Three Different Sea Areas in Korea
title_sort molecular analysis of anisakis type i larvae in marine fish from three different sea areas in korea
topic Original Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4170034/
https://www.ncbi.nlm.nih.gov/pubmed/25246717
http://dx.doi.org/10.3347/kjp.2014.52.4.383
work_keys_str_mv AT sohnwoonmok molecularanalysisofanisakistypeilarvaeinmarinefishfromthreedifferentseaareasinkorea
AT kangjungmi molecularanalysisofanisakistypeilarvaeinmarinefishfromthreedifferentseaareasinkorea
AT nabyoungkuk molecularanalysisofanisakistypeilarvaeinmarinefishfromthreedifferentseaareasinkorea