Cargando…
Molecular Analysis of Anisakis Type I Larvae in Marine Fish from Three Different Sea Areas in Korea
Anisakiasis, a human infection of Anisakis L3 larvae, is one of the common foodborne parasitic diseases in Korea. Studies on the identification of anisakid larvae have been performed in the country, but most of them have been focused on morphological identification of the larvae. In this study, we a...
Autores principales: | , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
The Korean Society for Parasitology and Tropical Medicine
2014
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4170034/ https://www.ncbi.nlm.nih.gov/pubmed/25246717 http://dx.doi.org/10.3347/kjp.2014.52.4.383 |
_version_ | 1782335782247202816 |
---|---|
author | Sohn, Woon-Mok Kang, Jung-Mi Na, Byoung-Kuk |
author_facet | Sohn, Woon-Mok Kang, Jung-Mi Na, Byoung-Kuk |
author_sort | Sohn, Woon-Mok |
collection | PubMed |
description | Anisakiasis, a human infection of Anisakis L3 larvae, is one of the common foodborne parasitic diseases in Korea. Studies on the identification of anisakid larvae have been performed in the country, but most of them have been focused on morphological identification of the larvae. In this study, we analyzed the molecular characteristics of 174 Anisakis type I larvae collected from 10 species of fish caught in 3 different sea areas in Korea. PCR-RFLP and sequence analyses of rDNA ITS and mtDNA cox1 revealed that the larvae showed interesting distribution patterns depending on fish species and geographical locations. Anisakis pegreffii was predominant in fish from the Yellow Sea and the South Sea. Meanwhile, both A. pegreffii and A. simplex sensu stricto (A. simplex s.str.) larvae were identified in fish from the East Sea, depending on fish species infected. These results suggested that A. pegreffii was primarily distributed in a diverse species of fish in 3 sea areas around Korea, but A. simplex s.str. was dominantly identified in Oncorhynchus spp. in the East Sea. |
format | Online Article Text |
id | pubmed-4170034 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2014 |
publisher | The Korean Society for Parasitology and Tropical Medicine |
record_format | MEDLINE/PubMed |
spelling | pubmed-41700342014-09-22 Molecular Analysis of Anisakis Type I Larvae in Marine Fish from Three Different Sea Areas in Korea Sohn, Woon-Mok Kang, Jung-Mi Na, Byoung-Kuk Korean J Parasitol Original Article Anisakiasis, a human infection of Anisakis L3 larvae, is one of the common foodborne parasitic diseases in Korea. Studies on the identification of anisakid larvae have been performed in the country, but most of them have been focused on morphological identification of the larvae. In this study, we analyzed the molecular characteristics of 174 Anisakis type I larvae collected from 10 species of fish caught in 3 different sea areas in Korea. PCR-RFLP and sequence analyses of rDNA ITS and mtDNA cox1 revealed that the larvae showed interesting distribution patterns depending on fish species and geographical locations. Anisakis pegreffii was predominant in fish from the Yellow Sea and the South Sea. Meanwhile, both A. pegreffii and A. simplex sensu stricto (A. simplex s.str.) larvae were identified in fish from the East Sea, depending on fish species infected. These results suggested that A. pegreffii was primarily distributed in a diverse species of fish in 3 sea areas around Korea, but A. simplex s.str. was dominantly identified in Oncorhynchus spp. in the East Sea. The Korean Society for Parasitology and Tropical Medicine 2014-08 2014-08-29 /pmc/articles/PMC4170034/ /pubmed/25246717 http://dx.doi.org/10.3347/kjp.2014.52.4.383 Text en © 2014, Korean Society for Parasitology and Tropical Medicine http://creativecommons.org/licenses/by-nc/3.0/ This is an Open Access article distributed under the terms of the Creative Commons Attribution Non-Commercial License (http://creativecommons.org/licenses/by-nc/3.0/) which permits unrestricted non-commercial use, distribution, and reproduction in any medium, provided the original work is properly cited. |
spellingShingle | Original Article Sohn, Woon-Mok Kang, Jung-Mi Na, Byoung-Kuk Molecular Analysis of Anisakis Type I Larvae in Marine Fish from Three Different Sea Areas in Korea |
title | Molecular Analysis of Anisakis Type I Larvae in Marine Fish from Three Different Sea Areas in Korea |
title_full | Molecular Analysis of Anisakis Type I Larvae in Marine Fish from Three Different Sea Areas in Korea |
title_fullStr | Molecular Analysis of Anisakis Type I Larvae in Marine Fish from Three Different Sea Areas in Korea |
title_full_unstemmed | Molecular Analysis of Anisakis Type I Larvae in Marine Fish from Three Different Sea Areas in Korea |
title_short | Molecular Analysis of Anisakis Type I Larvae in Marine Fish from Three Different Sea Areas in Korea |
title_sort | molecular analysis of anisakis type i larvae in marine fish from three different sea areas in korea |
topic | Original Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4170034/ https://www.ncbi.nlm.nih.gov/pubmed/25246717 http://dx.doi.org/10.3347/kjp.2014.52.4.383 |
work_keys_str_mv | AT sohnwoonmok molecularanalysisofanisakistypeilarvaeinmarinefishfromthreedifferentseaareasinkorea AT kangjungmi molecularanalysisofanisakistypeilarvaeinmarinefishfromthreedifferentseaareasinkorea AT nabyoungkuk molecularanalysisofanisakistypeilarvaeinmarinefishfromthreedifferentseaareasinkorea |