Cargando…
Systematic Reviews: Perhaps “The Answer to Policy Makers’ Prayers”?
| Autores principales: | , |
|---|---|
| Formato: | Online Artículo Texto |
| Lenguaje: | English |
| Publicado: |
NLM-Export
2014
|
| Materias: | |
| Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4181934/ https://www.ncbi.nlm.nih.gov/pubmed/25272205 http://dx.doi.org/10.1289/ehp.1408599 |
| _version_ | 1782337448993357824 |
|---|---|
| author | Fox, Daniel M. Bero, Lisa |
| author_facet | Fox, Daniel M. Bero, Lisa |
| author_sort | Fox, Daniel M. |
| collection | PubMed |
| description | |
| format | Online Article Text |
| id | pubmed-4181934 |
| institution | National Center for Biotechnology Information |
| language | English |
| publishDate | 2014 |
| publisher | NLM-Export |
| record_format | MEDLINE/PubMed |
| spelling | pubmed-41819342014-10-22 Systematic Reviews: Perhaps “The Answer to Policy Makers’ Prayers”? Fox, Daniel M. Bero, Lisa Environ Health Perspect Editorial NLM-Export 2014-10-01 2014-10 /pmc/articles/PMC4181934/ /pubmed/25272205 http://dx.doi.org/10.1289/ehp.1408599 Text en http://creativecommons.org/publicdomain/mark/1.0/ Publication of EHP lies in the public domain and is therefore without copyright. All text from EHP may be reprinted freely. Use of materials published in EHP should be acknowledged (for example, “Reproduced with permission from Environmental Health Perspectives”); pertinent reference information should be provided for the article from which the material was reproduced. Articles from EHP, especially the News section, may contain photographs or illustrations copyrighted by other commercial organizations or individuals that may not be used without obtaining prior approval from the holder of the copyright. |
| spellingShingle | Editorial Fox, Daniel M. Bero, Lisa Systematic Reviews: Perhaps “The Answer to Policy Makers’ Prayers”? |
| title | Systematic Reviews: Perhaps “The Answer to Policy Makers’ Prayers”? |
| title_full | Systematic Reviews: Perhaps “The Answer to Policy Makers’ Prayers”? |
| title_fullStr | Systematic Reviews: Perhaps “The Answer to Policy Makers’ Prayers”? |
| title_full_unstemmed | Systematic Reviews: Perhaps “The Answer to Policy Makers’ Prayers”? |
| title_short | Systematic Reviews: Perhaps “The Answer to Policy Makers’ Prayers”? |
| title_sort | systematic reviews: perhaps “the answer to policy makers’ prayers”? |
| topic | Editorial |
| url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4181934/ https://www.ncbi.nlm.nih.gov/pubmed/25272205 http://dx.doi.org/10.1289/ehp.1408599 |
| work_keys_str_mv | AT foxdanielm systematicreviewsperhapstheanswertopolicymakersprayers AT berolisa systematicreviewsperhapstheanswertopolicymakersprayers |