Cargando…

Human high-altitude adaptation: forward genetics meets the HIF pathway

Humans have adapted to the chronic hypoxia of high altitude in several locations, and recent genome-wide studies have indicated a genetic basis. In some populations, genetic signatures have been identified in the hypoxia-inducible factor (HIF) pathway, which orchestrates the transcriptional response...

Descripción completa

Detalles Bibliográficos
Autores principales: Bigham, Abigail W., Lee, Frank S.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Cold Spring Harbor Laboratory Press 2014
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4201282/
https://www.ncbi.nlm.nih.gov/pubmed/25319824
http://dx.doi.org/10.1101/gad.250167.114
_version_ 1782340155724529664
author Bigham, Abigail W.
Lee, Frank S.
author_facet Bigham, Abigail W.
Lee, Frank S.
author_sort Bigham, Abigail W.
collection PubMed
description Humans have adapted to the chronic hypoxia of high altitude in several locations, and recent genome-wide studies have indicated a genetic basis. In some populations, genetic signatures have been identified in the hypoxia-inducible factor (HIF) pathway, which orchestrates the transcriptional response to hypoxia. In Tibetans, they have been found in the HIF2A (EPAS1) gene, which encodes for HIF-2α, and the prolyl hydroxylase domain protein 2 (PHD2, also known as EGLN1) gene, which encodes for one of its key regulators, PHD2. High-altitude adaptation may be due to multiple genes that act in concert with one another. Unraveling their mechanism of action can offer new therapeutic approaches toward treating common human diseases characterized by chronic hypoxia.
format Online
Article
Text
id pubmed-4201282
institution National Center for Biotechnology Information
language English
publishDate 2014
publisher Cold Spring Harbor Laboratory Press
record_format MEDLINE/PubMed
spelling pubmed-42012822015-04-15 Human high-altitude adaptation: forward genetics meets the HIF pathway Bigham, Abigail W. Lee, Frank S. Genes Dev Review Humans have adapted to the chronic hypoxia of high altitude in several locations, and recent genome-wide studies have indicated a genetic basis. In some populations, genetic signatures have been identified in the hypoxia-inducible factor (HIF) pathway, which orchestrates the transcriptional response to hypoxia. In Tibetans, they have been found in the HIF2A (EPAS1) gene, which encodes for HIF-2α, and the prolyl hydroxylase domain protein 2 (PHD2, also known as EGLN1) gene, which encodes for one of its key regulators, PHD2. High-altitude adaptation may be due to multiple genes that act in concert with one another. Unraveling their mechanism of action can offer new therapeutic approaches toward treating common human diseases characterized by chronic hypoxia. Cold Spring Harbor Laboratory Press 2014-10-15 /pmc/articles/PMC4201282/ /pubmed/25319824 http://dx.doi.org/10.1101/gad.250167.114 Text en © 2014 Bigham and Lee; Published by Cold Spring Harbor Laboratory Press http://creativecommons.org/licenses/by-nc/4.0/ This article is distributed exclusively by Cold Spring Harbor Laboratory Press for the first six months after the full-issue publication date (see http://genesdev.cshlp.org/site/misc/terms.xhtml). After six months, it is available under a Creative Commons License (Attribution-NonCommercial 4.0 International), as described at http://creativecommons.org/licenses/by-nc/4.0/.
spellingShingle Review
Bigham, Abigail W.
Lee, Frank S.
Human high-altitude adaptation: forward genetics meets the HIF pathway
title Human high-altitude adaptation: forward genetics meets the HIF pathway
title_full Human high-altitude adaptation: forward genetics meets the HIF pathway
title_fullStr Human high-altitude adaptation: forward genetics meets the HIF pathway
title_full_unstemmed Human high-altitude adaptation: forward genetics meets the HIF pathway
title_short Human high-altitude adaptation: forward genetics meets the HIF pathway
title_sort human high-altitude adaptation: forward genetics meets the hif pathway
topic Review
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4201282/
https://www.ncbi.nlm.nih.gov/pubmed/25319824
http://dx.doi.org/10.1101/gad.250167.114
work_keys_str_mv AT bighamabigailw humanhighaltitudeadaptationforwardgeneticsmeetsthehifpathway
AT leefranks humanhighaltitudeadaptationforwardgeneticsmeetsthehifpathway