Cargando…
Human high-altitude adaptation: forward genetics meets the HIF pathway
Humans have adapted to the chronic hypoxia of high altitude in several locations, and recent genome-wide studies have indicated a genetic basis. In some populations, genetic signatures have been identified in the hypoxia-inducible factor (HIF) pathway, which orchestrates the transcriptional response...
Autores principales: | , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Cold Spring Harbor Laboratory Press
2014
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4201282/ https://www.ncbi.nlm.nih.gov/pubmed/25319824 http://dx.doi.org/10.1101/gad.250167.114 |
_version_ | 1782340155724529664 |
---|---|
author | Bigham, Abigail W. Lee, Frank S. |
author_facet | Bigham, Abigail W. Lee, Frank S. |
author_sort | Bigham, Abigail W. |
collection | PubMed |
description | Humans have adapted to the chronic hypoxia of high altitude in several locations, and recent genome-wide studies have indicated a genetic basis. In some populations, genetic signatures have been identified in the hypoxia-inducible factor (HIF) pathway, which orchestrates the transcriptional response to hypoxia. In Tibetans, they have been found in the HIF2A (EPAS1) gene, which encodes for HIF-2α, and the prolyl hydroxylase domain protein 2 (PHD2, also known as EGLN1) gene, which encodes for one of its key regulators, PHD2. High-altitude adaptation may be due to multiple genes that act in concert with one another. Unraveling their mechanism of action can offer new therapeutic approaches toward treating common human diseases characterized by chronic hypoxia. |
format | Online Article Text |
id | pubmed-4201282 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2014 |
publisher | Cold Spring Harbor Laboratory Press |
record_format | MEDLINE/PubMed |
spelling | pubmed-42012822015-04-15 Human high-altitude adaptation: forward genetics meets the HIF pathway Bigham, Abigail W. Lee, Frank S. Genes Dev Review Humans have adapted to the chronic hypoxia of high altitude in several locations, and recent genome-wide studies have indicated a genetic basis. In some populations, genetic signatures have been identified in the hypoxia-inducible factor (HIF) pathway, which orchestrates the transcriptional response to hypoxia. In Tibetans, they have been found in the HIF2A (EPAS1) gene, which encodes for HIF-2α, and the prolyl hydroxylase domain protein 2 (PHD2, also known as EGLN1) gene, which encodes for one of its key regulators, PHD2. High-altitude adaptation may be due to multiple genes that act in concert with one another. Unraveling their mechanism of action can offer new therapeutic approaches toward treating common human diseases characterized by chronic hypoxia. Cold Spring Harbor Laboratory Press 2014-10-15 /pmc/articles/PMC4201282/ /pubmed/25319824 http://dx.doi.org/10.1101/gad.250167.114 Text en © 2014 Bigham and Lee; Published by Cold Spring Harbor Laboratory Press http://creativecommons.org/licenses/by-nc/4.0/ This article is distributed exclusively by Cold Spring Harbor Laboratory Press for the first six months after the full-issue publication date (see http://genesdev.cshlp.org/site/misc/terms.xhtml). After six months, it is available under a Creative Commons License (Attribution-NonCommercial 4.0 International), as described at http://creativecommons.org/licenses/by-nc/4.0/. |
spellingShingle | Review Bigham, Abigail W. Lee, Frank S. Human high-altitude adaptation: forward genetics meets the HIF pathway |
title | Human high-altitude adaptation: forward genetics meets the HIF pathway |
title_full | Human high-altitude adaptation: forward genetics meets the HIF pathway |
title_fullStr | Human high-altitude adaptation: forward genetics meets the HIF pathway |
title_full_unstemmed | Human high-altitude adaptation: forward genetics meets the HIF pathway |
title_short | Human high-altitude adaptation: forward genetics meets the HIF pathway |
title_sort | human high-altitude adaptation: forward genetics meets the hif pathway |
topic | Review |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4201282/ https://www.ncbi.nlm.nih.gov/pubmed/25319824 http://dx.doi.org/10.1101/gad.250167.114 |
work_keys_str_mv | AT bighamabigailw humanhighaltitudeadaptationforwardgeneticsmeetsthehifpathway AT leefranks humanhighaltitudeadaptationforwardgeneticsmeetsthehifpathway |