Cargando…
Larvicidal activity of Agave sisalana against Aedes aegypti mosquito, the dengue vector
| Autores principales: | , , , , |
|---|---|
| Formato: | Online Artículo Texto |
| Lenguaje: | English |
| Publicado: |
BioMed Central
2014
|
| Materias: | |
| Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4204313/ http://dx.doi.org/10.1186/1753-6561-8-S4-P5 |
| _version_ | 1782340543635783680 |
|---|---|
| author | Nunes, Fabiola Guimarães, Louise Lacerda, Debora Mascarenhas, Sandra Braga, Valdir |
| author_facet | Nunes, Fabiola Guimarães, Louise Lacerda, Debora Mascarenhas, Sandra Braga, Valdir |
| author_sort | Nunes, Fabiola |
| collection | PubMed |
| description | |
| format | Online Article Text |
| id | pubmed-4204313 |
| institution | National Center for Biotechnology Information |
| language | English |
| publishDate | 2014 |
| publisher | BioMed Central |
| record_format | MEDLINE/PubMed |
| spelling | pubmed-42043132014-11-05 Larvicidal activity of Agave sisalana against Aedes aegypti mosquito, the dengue vector Nunes, Fabiola Guimarães, Louise Lacerda, Debora Mascarenhas, Sandra Braga, Valdir BMC Proc Poster Presentation BioMed Central 2014-10-01 /pmc/articles/PMC4204313/ http://dx.doi.org/10.1186/1753-6561-8-S4-P5 Text en Copyright © 2014 Nunes et al.; licensee BioMed Central Ltd. http://creativecommons.org/licenses/by/4.0 This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
| spellingShingle | Poster Presentation Nunes, Fabiola Guimarães, Louise Lacerda, Debora Mascarenhas, Sandra Braga, Valdir Larvicidal activity of Agave sisalana against Aedes aegypti mosquito, the dengue vector |
| title | Larvicidal activity of Agave sisalana against Aedes aegypti mosquito, the dengue vector |
| title_full | Larvicidal activity of Agave sisalana against Aedes aegypti mosquito, the dengue vector |
| title_fullStr | Larvicidal activity of Agave sisalana against Aedes aegypti mosquito, the dengue vector |
| title_full_unstemmed | Larvicidal activity of Agave sisalana against Aedes aegypti mosquito, the dengue vector |
| title_short | Larvicidal activity of Agave sisalana against Aedes aegypti mosquito, the dengue vector |
| title_sort | larvicidal activity of agave sisalana against aedes aegypti mosquito, the dengue vector |
| topic | Poster Presentation |
| url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4204313/ http://dx.doi.org/10.1186/1753-6561-8-S4-P5 |
| work_keys_str_mv | AT nunesfabiola larvicidalactivityofagavesisalanaagainstaedesaegyptimosquitothedenguevector AT guimaraeslouise larvicidalactivityofagavesisalanaagainstaedesaegyptimosquitothedenguevector AT lacerdadebora larvicidalactivityofagavesisalanaagainstaedesaegyptimosquitothedenguevector AT mascarenhassandra larvicidalactivityofagavesisalanaagainstaedesaegyptimosquitothedenguevector AT bragavaldir larvicidalactivityofagavesisalanaagainstaedesaegyptimosquitothedenguevector |