Cargando…
Phenotypic and Proteomic Characteristics of Human Dental Pulp Derived Mesenchymal Stem Cells from a Natal, an Exfoliated Deciduous, and an Impacted Third Molar Tooth
The level of heterogeneity among the isolated stem cells makes them less valuable for clinical use. The purpose of this study was to understand the level of heterogeneity among human dental pulp derived mesenchymal stem cells by using basic cell biology and proteomic approaches. The cells were isola...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Hindawi Publishing Corporation
2014
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4212660/ https://www.ncbi.nlm.nih.gov/pubmed/25379041 http://dx.doi.org/10.1155/2014/457059 |
_version_ | 1782341736167636992 |
---|---|
author | Akpinar, Gurler Kasap, Murat Aksoy, Ayca Duruksu, Gokhan Gacar, Gulcin Karaoz, Erdal |
author_facet | Akpinar, Gurler Kasap, Murat Aksoy, Ayca Duruksu, Gokhan Gacar, Gulcin Karaoz, Erdal |
author_sort | Akpinar, Gurler |
collection | PubMed |
description | The level of heterogeneity among the isolated stem cells makes them less valuable for clinical use. The purpose of this study was to understand the level of heterogeneity among human dental pulp derived mesenchymal stem cells by using basic cell biology and proteomic approaches. The cells were isolated from a natal (NDPSCs), an exfoliated deciduous (stem cells from human exfoliated deciduous (SHED)), and an impacted third molar (DPSCs) tooth of three different donors. All three stem cells displayed similar features related to morphology, proliferation rates, expression of various cell surface markers, and differentiation potentials into adipocytes, osteocytes, and chondrocytes. Furthermore, using 2DE approach coupled with MALDI-TOF/TOF, we have generated a common 2DE profile for all three stem cells. We found that 62.3 ± 7% of the protein spots were conserved among the three mesenchymal stem cell lines. Sixty-one of these conserved spots were identified by MALDI-TOF/TOF analysis. Classification of the identified proteins based on biological function revealed that structurally important proteins and proteins that are involved in protein folding machinery are predominantly expressed by all three stem cell lines. Some of these proteins may hold importance in understanding specific properties of human dental pulp derived mesenchymal stem cells. |
format | Online Article Text |
id | pubmed-4212660 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2014 |
publisher | Hindawi Publishing Corporation |
record_format | MEDLINE/PubMed |
spelling | pubmed-42126602014-11-06 Phenotypic and Proteomic Characteristics of Human Dental Pulp Derived Mesenchymal Stem Cells from a Natal, an Exfoliated Deciduous, and an Impacted Third Molar Tooth Akpinar, Gurler Kasap, Murat Aksoy, Ayca Duruksu, Gokhan Gacar, Gulcin Karaoz, Erdal Stem Cells Int Research Article The level of heterogeneity among the isolated stem cells makes them less valuable for clinical use. The purpose of this study was to understand the level of heterogeneity among human dental pulp derived mesenchymal stem cells by using basic cell biology and proteomic approaches. The cells were isolated from a natal (NDPSCs), an exfoliated deciduous (stem cells from human exfoliated deciduous (SHED)), and an impacted third molar (DPSCs) tooth of three different donors. All three stem cells displayed similar features related to morphology, proliferation rates, expression of various cell surface markers, and differentiation potentials into adipocytes, osteocytes, and chondrocytes. Furthermore, using 2DE approach coupled with MALDI-TOF/TOF, we have generated a common 2DE profile for all three stem cells. We found that 62.3 ± 7% of the protein spots were conserved among the three mesenchymal stem cell lines. Sixty-one of these conserved spots were identified by MALDI-TOF/TOF analysis. Classification of the identified proteins based on biological function revealed that structurally important proteins and proteins that are involved in protein folding machinery are predominantly expressed by all three stem cell lines. Some of these proteins may hold importance in understanding specific properties of human dental pulp derived mesenchymal stem cells. Hindawi Publishing Corporation 2014 2014-10-14 /pmc/articles/PMC4212660/ /pubmed/25379041 http://dx.doi.org/10.1155/2014/457059 Text en Copyright © 2014 Gurler Akpinar et al. https://creativecommons.org/licenses/by/3.0/ This is an open access article distributed under the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. |
spellingShingle | Research Article Akpinar, Gurler Kasap, Murat Aksoy, Ayca Duruksu, Gokhan Gacar, Gulcin Karaoz, Erdal Phenotypic and Proteomic Characteristics of Human Dental Pulp Derived Mesenchymal Stem Cells from a Natal, an Exfoliated Deciduous, and an Impacted Third Molar Tooth |
title | Phenotypic and Proteomic Characteristics of Human Dental Pulp Derived Mesenchymal Stem Cells from a Natal, an Exfoliated Deciduous, and an Impacted Third Molar Tooth |
title_full | Phenotypic and Proteomic Characteristics of Human Dental Pulp Derived Mesenchymal Stem Cells from a Natal, an Exfoliated Deciduous, and an Impacted Third Molar Tooth |
title_fullStr | Phenotypic and Proteomic Characteristics of Human Dental Pulp Derived Mesenchymal Stem Cells from a Natal, an Exfoliated Deciduous, and an Impacted Third Molar Tooth |
title_full_unstemmed | Phenotypic and Proteomic Characteristics of Human Dental Pulp Derived Mesenchymal Stem Cells from a Natal, an Exfoliated Deciduous, and an Impacted Third Molar Tooth |
title_short | Phenotypic and Proteomic Characteristics of Human Dental Pulp Derived Mesenchymal Stem Cells from a Natal, an Exfoliated Deciduous, and an Impacted Third Molar Tooth |
title_sort | phenotypic and proteomic characteristics of human dental pulp derived mesenchymal stem cells from a natal, an exfoliated deciduous, and an impacted third molar tooth |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4212660/ https://www.ncbi.nlm.nih.gov/pubmed/25379041 http://dx.doi.org/10.1155/2014/457059 |
work_keys_str_mv | AT akpinargurler phenotypicandproteomiccharacteristicsofhumandentalpulpderivedmesenchymalstemcellsfromanatalanexfoliateddeciduousandanimpactedthirdmolartooth AT kasapmurat phenotypicandproteomiccharacteristicsofhumandentalpulpderivedmesenchymalstemcellsfromanatalanexfoliateddeciduousandanimpactedthirdmolartooth AT aksoyayca phenotypicandproteomiccharacteristicsofhumandentalpulpderivedmesenchymalstemcellsfromanatalanexfoliateddeciduousandanimpactedthirdmolartooth AT duruksugokhan phenotypicandproteomiccharacteristicsofhumandentalpulpderivedmesenchymalstemcellsfromanatalanexfoliateddeciduousandanimpactedthirdmolartooth AT gacargulcin phenotypicandproteomiccharacteristicsofhumandentalpulpderivedmesenchymalstemcellsfromanatalanexfoliateddeciduousandanimpactedthirdmolartooth AT karaozerdal phenotypicandproteomiccharacteristicsofhumandentalpulpderivedmesenchymalstemcellsfromanatalanexfoliateddeciduousandanimpactedthirdmolartooth |