Cargando…

Whole exome sequencing reveals novel COL4A3 and COL4A4 mutations and resolves diagnosis in Chinese families with kidney disease

BACKGROUND: Collagen IV-related nephropathies, including thin basement membrane nephropathy and Alport Syndrome (AS), are caused by defects in the genes COL4A3, COL4A4 and COL4A5. Diagnosis of these conditions can be hindered by variable penetrance and the presence of non-specific clinical or pathol...

Descripción completa

Detalles Bibliográficos
Autores principales: Lin, Fujun, Bian, Fan, Zou, Jun, Wu, Xiangru, Shan, Jianping, Lu, Wei, Yao, Yao, Jiang, Gengru, Gale, Daniel Philip
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2014
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4233041/
https://www.ncbi.nlm.nih.gov/pubmed/25381091
http://dx.doi.org/10.1186/1471-2369-15-175
_version_ 1782344675913367552
author Lin, Fujun
Bian, Fan
Zou, Jun
Wu, Xiangru
Shan, Jianping
Lu, Wei
Yao, Yao
Jiang, Gengru
Gale, Daniel Philip
author_facet Lin, Fujun
Bian, Fan
Zou, Jun
Wu, Xiangru
Shan, Jianping
Lu, Wei
Yao, Yao
Jiang, Gengru
Gale, Daniel Philip
author_sort Lin, Fujun
collection PubMed
description BACKGROUND: Collagen IV-related nephropathies, including thin basement membrane nephropathy and Alport Syndrome (AS), are caused by defects in the genes COL4A3, COL4A4 and COL4A5. Diagnosis of these conditions can be hindered by variable penetrance and the presence of non-specific clinical or pathological features. METHODS: Three families with unexplained inherited kidney disease were recruited from Shanghai, China. Whole exome sequencing (WES) was performed in the index case from each family and co-segregation of candidate pathogenic mutations was tested by Sanger sequencing. RESULTS: We identified COL4A4 missense variants [c.G2636A (p.Gly879Glu) and c.C4715T (p.Pro1572Leu)] in the 21-year-old male proband from family 1, who had been diagnosed with mesangial proliferative nephropathy at age 14. COL4A4 c.G2636A, a novel variant, co-segregated with renal disease among maternal relatives. COL4A4 c.C4715T has previously been associated with autosomal recessive AS and was inherited from his clinically unaffected father. In family 2, a novel COL4A3 missense mutation c.G2290A (p.Gly997Glu) was identified in a 45-year-old male diagnosed with focal segmental glomerulosclerosis and was present in all his affected family members, who exhibited disease ranging from isolated microscopic hematuria to end stage renal disease (ESRD). In family 3, ESRD occurred in both male and females who were found to harbor a known AS-causing COL4A5 donor splice site mutation (c.687 + 1G > A). None of these variants were detected among 100 healthy Chinese individuals. CONCLUSION: WES identified 2 novel and 2 known pathogenic COL4A3/COL4A4/COL4A5 mutations in 3 families with previously unexplained inherited kidney disease. These findings highlight the clinical range of collagen IV-related nephropathies and resolved diagnostic confusion arising from atypical or incomplete clinical/histological findings, allowing appropriate counselling and treatment advice to be given. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/1471-2369-15-175) contains supplementary material, which is available to authorized users.
format Online
Article
Text
id pubmed-4233041
institution National Center for Biotechnology Information
language English
publishDate 2014
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-42330412014-11-17 Whole exome sequencing reveals novel COL4A3 and COL4A4 mutations and resolves diagnosis in Chinese families with kidney disease Lin, Fujun Bian, Fan Zou, Jun Wu, Xiangru Shan, Jianping Lu, Wei Yao, Yao Jiang, Gengru Gale, Daniel Philip BMC Nephrol Research Article BACKGROUND: Collagen IV-related nephropathies, including thin basement membrane nephropathy and Alport Syndrome (AS), are caused by defects in the genes COL4A3, COL4A4 and COL4A5. Diagnosis of these conditions can be hindered by variable penetrance and the presence of non-specific clinical or pathological features. METHODS: Three families with unexplained inherited kidney disease were recruited from Shanghai, China. Whole exome sequencing (WES) was performed in the index case from each family and co-segregation of candidate pathogenic mutations was tested by Sanger sequencing. RESULTS: We identified COL4A4 missense variants [c.G2636A (p.Gly879Glu) and c.C4715T (p.Pro1572Leu)] in the 21-year-old male proband from family 1, who had been diagnosed with mesangial proliferative nephropathy at age 14. COL4A4 c.G2636A, a novel variant, co-segregated with renal disease among maternal relatives. COL4A4 c.C4715T has previously been associated with autosomal recessive AS and was inherited from his clinically unaffected father. In family 2, a novel COL4A3 missense mutation c.G2290A (p.Gly997Glu) was identified in a 45-year-old male diagnosed with focal segmental glomerulosclerosis and was present in all his affected family members, who exhibited disease ranging from isolated microscopic hematuria to end stage renal disease (ESRD). In family 3, ESRD occurred in both male and females who were found to harbor a known AS-causing COL4A5 donor splice site mutation (c.687 + 1G > A). None of these variants were detected among 100 healthy Chinese individuals. CONCLUSION: WES identified 2 novel and 2 known pathogenic COL4A3/COL4A4/COL4A5 mutations in 3 families with previously unexplained inherited kidney disease. These findings highlight the clinical range of collagen IV-related nephropathies and resolved diagnostic confusion arising from atypical or incomplete clinical/histological findings, allowing appropriate counselling and treatment advice to be given. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/1471-2369-15-175) contains supplementary material, which is available to authorized users. BioMed Central 2014-11-07 /pmc/articles/PMC4233041/ /pubmed/25381091 http://dx.doi.org/10.1186/1471-2369-15-175 Text en © Lin et al.; licensee BioMed Central Ltd. 2014 This article is published under license to BioMed Central Ltd. This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly credited. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research Article
Lin, Fujun
Bian, Fan
Zou, Jun
Wu, Xiangru
Shan, Jianping
Lu, Wei
Yao, Yao
Jiang, Gengru
Gale, Daniel Philip
Whole exome sequencing reveals novel COL4A3 and COL4A4 mutations and resolves diagnosis in Chinese families with kidney disease
title Whole exome sequencing reveals novel COL4A3 and COL4A4 mutations and resolves diagnosis in Chinese families with kidney disease
title_full Whole exome sequencing reveals novel COL4A3 and COL4A4 mutations and resolves diagnosis in Chinese families with kidney disease
title_fullStr Whole exome sequencing reveals novel COL4A3 and COL4A4 mutations and resolves diagnosis in Chinese families with kidney disease
title_full_unstemmed Whole exome sequencing reveals novel COL4A3 and COL4A4 mutations and resolves diagnosis in Chinese families with kidney disease
title_short Whole exome sequencing reveals novel COL4A3 and COL4A4 mutations and resolves diagnosis in Chinese families with kidney disease
title_sort whole exome sequencing reveals novel col4a3 and col4a4 mutations and resolves diagnosis in chinese families with kidney disease
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4233041/
https://www.ncbi.nlm.nih.gov/pubmed/25381091
http://dx.doi.org/10.1186/1471-2369-15-175
work_keys_str_mv AT linfujun wholeexomesequencingrevealsnovelcol4a3andcol4a4mutationsandresolvesdiagnosisinchinesefamilieswithkidneydisease
AT bianfan wholeexomesequencingrevealsnovelcol4a3andcol4a4mutationsandresolvesdiagnosisinchinesefamilieswithkidneydisease
AT zoujun wholeexomesequencingrevealsnovelcol4a3andcol4a4mutationsandresolvesdiagnosisinchinesefamilieswithkidneydisease
AT wuxiangru wholeexomesequencingrevealsnovelcol4a3andcol4a4mutationsandresolvesdiagnosisinchinesefamilieswithkidneydisease
AT shanjianping wholeexomesequencingrevealsnovelcol4a3andcol4a4mutationsandresolvesdiagnosisinchinesefamilieswithkidneydisease
AT luwei wholeexomesequencingrevealsnovelcol4a3andcol4a4mutationsandresolvesdiagnosisinchinesefamilieswithkidneydisease
AT yaoyao wholeexomesequencingrevealsnovelcol4a3andcol4a4mutationsandresolvesdiagnosisinchinesefamilieswithkidneydisease
AT jianggengru wholeexomesequencingrevealsnovelcol4a3andcol4a4mutationsandresolvesdiagnosisinchinesefamilieswithkidneydisease
AT galedanielphilip wholeexomesequencingrevealsnovelcol4a3andcol4a4mutationsandresolvesdiagnosisinchinesefamilieswithkidneydisease