Cargando…

Association between long working hours and serum gamma-glutamyltransferase levels in female workers: data from the fifth Korean National Health and Nutrition Examination Survey (2010-2011)

OBJECTIVES: The present study investigated the association between long working hours and serum gamma-glutamyltransferase (GGT) levels, a factor influencing the incidence of cardiovascular disease. METHODS: Data from the fifth Korean National Health and Nutrition Examination Survey (2010–2011) were...

Descripción completa

Detalles Bibliográficos
Autores principales: Park, Seung-Gwon, Lee, Yong-Jin, Ham, Jung-Oh, Jang, Eun-Chul, Kim, Seong-Woo, Park, Hyun
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2014
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4248444/
https://www.ncbi.nlm.nih.gov/pubmed/25452851
http://dx.doi.org/10.1186/s40557-014-0040-1
_version_ 1782346804024573952
author Park, Seung-Gwon
Lee, Yong-Jin
Ham, Jung-Oh
Jang, Eun-Chul
Kim, Seong-Woo
Park, Hyun
author_facet Park, Seung-Gwon
Lee, Yong-Jin
Ham, Jung-Oh
Jang, Eun-Chul
Kim, Seong-Woo
Park, Hyun
author_sort Park, Seung-Gwon
collection PubMed
description OBJECTIVES: The present study investigated the association between long working hours and serum gamma-glutamyltransferase (GGT) levels, a factor influencing the incidence of cardiovascular disease. METHODS: Data from the fifth Korean National Health and Nutrition Examination Survey (2010–2011) were used to analyze 1,809 women. Subjects were divided into three groups based on the number of weekly working hours: ≤29, 30–51, and ≥52 hours per week. Complex samples logistic regression was performed after adjusting for general and occupational factors to determine the association between long working hours and high serum GGT levels. RESULTS: The prevalence of high serum GGT levels in groups with ≤29, 30–51, and ≥52 working hours per week was 22.0%, 16.9%, and 26.6%, respectively. Even after adjusting for general and occupational factors, those working 30–51 hours per week had the lowest prevalence of high serum GGT levels. Compared to those working 30–51 hours per week, the odds ratios (OR) of having high serum GGT levels in the groups with ≥52 and ≤29 working hours per week were 1.56 (95% confidence interval [CI], 1.10–2.23) and 1.53 (95% CI, 1.05–2.24), respectively. CONCLUSIONS: Long working hours were significantly associated with high serum GGT levels in Korean women.
format Online
Article
Text
id pubmed-4248444
institution National Center for Biotechnology Information
language English
publishDate 2014
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-42484442014-12-02 Association between long working hours and serum gamma-glutamyltransferase levels in female workers: data from the fifth Korean National Health and Nutrition Examination Survey (2010-2011) Park, Seung-Gwon Lee, Yong-Jin Ham, Jung-Oh Jang, Eun-Chul Kim, Seong-Woo Park, Hyun Ann Occup Environ Med Research Article OBJECTIVES: The present study investigated the association between long working hours and serum gamma-glutamyltransferase (GGT) levels, a factor influencing the incidence of cardiovascular disease. METHODS: Data from the fifth Korean National Health and Nutrition Examination Survey (2010–2011) were used to analyze 1,809 women. Subjects were divided into three groups based on the number of weekly working hours: ≤29, 30–51, and ≥52 hours per week. Complex samples logistic regression was performed after adjusting for general and occupational factors to determine the association between long working hours and high serum GGT levels. RESULTS: The prevalence of high serum GGT levels in groups with ≤29, 30–51, and ≥52 working hours per week was 22.0%, 16.9%, and 26.6%, respectively. Even after adjusting for general and occupational factors, those working 30–51 hours per week had the lowest prevalence of high serum GGT levels. Compared to those working 30–51 hours per week, the odds ratios (OR) of having high serum GGT levels in the groups with ≥52 and ≤29 working hours per week were 1.56 (95% confidence interval [CI], 1.10–2.23) and 1.53 (95% CI, 1.05–2.24), respectively. CONCLUSIONS: Long working hours were significantly associated with high serum GGT levels in Korean women. BioMed Central 2014-12-01 /pmc/articles/PMC4248444/ /pubmed/25452851 http://dx.doi.org/10.1186/s40557-014-0040-1 Text en © Park et al.; licensee BioMed Central Ltd. 2014 This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly credited. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research Article
Park, Seung-Gwon
Lee, Yong-Jin
Ham, Jung-Oh
Jang, Eun-Chul
Kim, Seong-Woo
Park, Hyun
Association between long working hours and serum gamma-glutamyltransferase levels in female workers: data from the fifth Korean National Health and Nutrition Examination Survey (2010-2011)
title Association between long working hours and serum gamma-glutamyltransferase levels in female workers: data from the fifth Korean National Health and Nutrition Examination Survey (2010-2011)
title_full Association between long working hours and serum gamma-glutamyltransferase levels in female workers: data from the fifth Korean National Health and Nutrition Examination Survey (2010-2011)
title_fullStr Association between long working hours and serum gamma-glutamyltransferase levels in female workers: data from the fifth Korean National Health and Nutrition Examination Survey (2010-2011)
title_full_unstemmed Association between long working hours and serum gamma-glutamyltransferase levels in female workers: data from the fifth Korean National Health and Nutrition Examination Survey (2010-2011)
title_short Association between long working hours and serum gamma-glutamyltransferase levels in female workers: data from the fifth Korean National Health and Nutrition Examination Survey (2010-2011)
title_sort association between long working hours and serum gamma-glutamyltransferase levels in female workers: data from the fifth korean national health and nutrition examination survey (2010-2011)
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4248444/
https://www.ncbi.nlm.nih.gov/pubmed/25452851
http://dx.doi.org/10.1186/s40557-014-0040-1
work_keys_str_mv AT parkseunggwon associationbetweenlongworkinghoursandserumgammaglutamyltransferaselevelsinfemaleworkersdatafromthefifthkoreannationalhealthandnutritionexaminationsurvey20102011
AT leeyongjin associationbetweenlongworkinghoursandserumgammaglutamyltransferaselevelsinfemaleworkersdatafromthefifthkoreannationalhealthandnutritionexaminationsurvey20102011
AT hamjungoh associationbetweenlongworkinghoursandserumgammaglutamyltransferaselevelsinfemaleworkersdatafromthefifthkoreannationalhealthandnutritionexaminationsurvey20102011
AT jangeunchul associationbetweenlongworkinghoursandserumgammaglutamyltransferaselevelsinfemaleworkersdatafromthefifthkoreannationalhealthandnutritionexaminationsurvey20102011
AT kimseongwoo associationbetweenlongworkinghoursandserumgammaglutamyltransferaselevelsinfemaleworkersdatafromthefifthkoreannationalhealthandnutritionexaminationsurvey20102011
AT parkhyun associationbetweenlongworkinghoursandserumgammaglutamyltransferaselevelsinfemaleworkersdatafromthefifthkoreannationalhealthandnutritionexaminationsurvey20102011