Cargando…
Association between long working hours and serum gamma-glutamyltransferase levels in female workers: data from the fifth Korean National Health and Nutrition Examination Survey (2010-2011)
OBJECTIVES: The present study investigated the association between long working hours and serum gamma-glutamyltransferase (GGT) levels, a factor influencing the incidence of cardiovascular disease. METHODS: Data from the fifth Korean National Health and Nutrition Examination Survey (2010–2011) were...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2014
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4248444/ https://www.ncbi.nlm.nih.gov/pubmed/25452851 http://dx.doi.org/10.1186/s40557-014-0040-1 |
_version_ | 1782346804024573952 |
---|---|
author | Park, Seung-Gwon Lee, Yong-Jin Ham, Jung-Oh Jang, Eun-Chul Kim, Seong-Woo Park, Hyun |
author_facet | Park, Seung-Gwon Lee, Yong-Jin Ham, Jung-Oh Jang, Eun-Chul Kim, Seong-Woo Park, Hyun |
author_sort | Park, Seung-Gwon |
collection | PubMed |
description | OBJECTIVES: The present study investigated the association between long working hours and serum gamma-glutamyltransferase (GGT) levels, a factor influencing the incidence of cardiovascular disease. METHODS: Data from the fifth Korean National Health and Nutrition Examination Survey (2010–2011) were used to analyze 1,809 women. Subjects were divided into three groups based on the number of weekly working hours: ≤29, 30–51, and ≥52 hours per week. Complex samples logistic regression was performed after adjusting for general and occupational factors to determine the association between long working hours and high serum GGT levels. RESULTS: The prevalence of high serum GGT levels in groups with ≤29, 30–51, and ≥52 working hours per week was 22.0%, 16.9%, and 26.6%, respectively. Even after adjusting for general and occupational factors, those working 30–51 hours per week had the lowest prevalence of high serum GGT levels. Compared to those working 30–51 hours per week, the odds ratios (OR) of having high serum GGT levels in the groups with ≥52 and ≤29 working hours per week were 1.56 (95% confidence interval [CI], 1.10–2.23) and 1.53 (95% CI, 1.05–2.24), respectively. CONCLUSIONS: Long working hours were significantly associated with high serum GGT levels in Korean women. |
format | Online Article Text |
id | pubmed-4248444 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2014 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-42484442014-12-02 Association between long working hours and serum gamma-glutamyltransferase levels in female workers: data from the fifth Korean National Health and Nutrition Examination Survey (2010-2011) Park, Seung-Gwon Lee, Yong-Jin Ham, Jung-Oh Jang, Eun-Chul Kim, Seong-Woo Park, Hyun Ann Occup Environ Med Research Article OBJECTIVES: The present study investigated the association between long working hours and serum gamma-glutamyltransferase (GGT) levels, a factor influencing the incidence of cardiovascular disease. METHODS: Data from the fifth Korean National Health and Nutrition Examination Survey (2010–2011) were used to analyze 1,809 women. Subjects were divided into three groups based on the number of weekly working hours: ≤29, 30–51, and ≥52 hours per week. Complex samples logistic regression was performed after adjusting for general and occupational factors to determine the association between long working hours and high serum GGT levels. RESULTS: The prevalence of high serum GGT levels in groups with ≤29, 30–51, and ≥52 working hours per week was 22.0%, 16.9%, and 26.6%, respectively. Even after adjusting for general and occupational factors, those working 30–51 hours per week had the lowest prevalence of high serum GGT levels. Compared to those working 30–51 hours per week, the odds ratios (OR) of having high serum GGT levels in the groups with ≥52 and ≤29 working hours per week were 1.56 (95% confidence interval [CI], 1.10–2.23) and 1.53 (95% CI, 1.05–2.24), respectively. CONCLUSIONS: Long working hours were significantly associated with high serum GGT levels in Korean women. BioMed Central 2014-12-01 /pmc/articles/PMC4248444/ /pubmed/25452851 http://dx.doi.org/10.1186/s40557-014-0040-1 Text en © Park et al.; licensee BioMed Central Ltd. 2014 This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly credited. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Research Article Park, Seung-Gwon Lee, Yong-Jin Ham, Jung-Oh Jang, Eun-Chul Kim, Seong-Woo Park, Hyun Association between long working hours and serum gamma-glutamyltransferase levels in female workers: data from the fifth Korean National Health and Nutrition Examination Survey (2010-2011) |
title | Association between long working hours and serum gamma-glutamyltransferase levels in female workers: data from the fifth Korean National Health and Nutrition Examination Survey (2010-2011) |
title_full | Association between long working hours and serum gamma-glutamyltransferase levels in female workers: data from the fifth Korean National Health and Nutrition Examination Survey (2010-2011) |
title_fullStr | Association between long working hours and serum gamma-glutamyltransferase levels in female workers: data from the fifth Korean National Health and Nutrition Examination Survey (2010-2011) |
title_full_unstemmed | Association between long working hours and serum gamma-glutamyltransferase levels in female workers: data from the fifth Korean National Health and Nutrition Examination Survey (2010-2011) |
title_short | Association between long working hours and serum gamma-glutamyltransferase levels in female workers: data from the fifth Korean National Health and Nutrition Examination Survey (2010-2011) |
title_sort | association between long working hours and serum gamma-glutamyltransferase levels in female workers: data from the fifth korean national health and nutrition examination survey (2010-2011) |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4248444/ https://www.ncbi.nlm.nih.gov/pubmed/25452851 http://dx.doi.org/10.1186/s40557-014-0040-1 |
work_keys_str_mv | AT parkseunggwon associationbetweenlongworkinghoursandserumgammaglutamyltransferaselevelsinfemaleworkersdatafromthefifthkoreannationalhealthandnutritionexaminationsurvey20102011 AT leeyongjin associationbetweenlongworkinghoursandserumgammaglutamyltransferaselevelsinfemaleworkersdatafromthefifthkoreannationalhealthandnutritionexaminationsurvey20102011 AT hamjungoh associationbetweenlongworkinghoursandserumgammaglutamyltransferaselevelsinfemaleworkersdatafromthefifthkoreannationalhealthandnutritionexaminationsurvey20102011 AT jangeunchul associationbetweenlongworkinghoursandserumgammaglutamyltransferaselevelsinfemaleworkersdatafromthefifthkoreannationalhealthandnutritionexaminationsurvey20102011 AT kimseongwoo associationbetweenlongworkinghoursandserumgammaglutamyltransferaselevelsinfemaleworkersdatafromthefifthkoreannationalhealthandnutritionexaminationsurvey20102011 AT parkhyun associationbetweenlongworkinghoursandserumgammaglutamyltransferaselevelsinfemaleworkersdatafromthefifthkoreannationalhealthandnutritionexaminationsurvey20102011 |