Cargando…
A novel DAG-dependent mechanism links PKCa and Cyclin B1 regulating cell cycle progression
Through the years, different studies showed the involvement of Protein Kinase C (PKC) in cell cycle control, in particular during G1/S transition. Little is known about their role at G2/M checkpoint. In this study, using K562 human erythroleukemia cell line, we found a novel and specific mechanism t...
Autores principales: | , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Impact Journals LLC
2014
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4294327/ https://www.ncbi.nlm.nih.gov/pubmed/25362646 |
_version_ | 1782352707772743680 |
---|---|
author | Poli, Alessandro Ramazzotti, Giulia Matteucci, Alessandro Manzoli, Lucia Lonetti, Annalisa Suh, Pann-Ghill McCubrey, James A. Cocco, Lucio |
author_facet | Poli, Alessandro Ramazzotti, Giulia Matteucci, Alessandro Manzoli, Lucia Lonetti, Annalisa Suh, Pann-Ghill McCubrey, James A. Cocco, Lucio |
author_sort | Poli, Alessandro |
collection | PubMed |
description | Through the years, different studies showed the involvement of Protein Kinase C (PKC) in cell cycle control, in particular during G1/S transition. Little is known about their role at G2/M checkpoint. In this study, using K562 human erythroleukemia cell line, we found a novel and specific mechanism through which the conventional isoform PKC⍺ positively affects Cyclin B1 modulating G2/M progression of cell cycle. Since the kinase activity of this PKC isoform was not necessary in this process, we demonstrated that PKC⍺, physically interacting with Cyclin B1, avoided its degradation and stimulated its nuclear import at mitosis. Moreover, the process resulted to be strictly connected with the increase in nuclear diacylglycerol levels (DAG) at G2/M checkpoint, due to the activity of nuclear Phospholipase C β1 (PLCβ1), the only PLC isoform mainly localized in the nucleus of K562 cells. Taken together, our findings indicated a novel DAG dependent mechanism able to regulate the G2/M progression of the cell cycle. |
format | Online Article Text |
id | pubmed-4294327 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2014 |
publisher | Impact Journals LLC |
record_format | MEDLINE/PubMed |
spelling | pubmed-42943272015-01-21 A novel DAG-dependent mechanism links PKCa and Cyclin B1 regulating cell cycle progression Poli, Alessandro Ramazzotti, Giulia Matteucci, Alessandro Manzoli, Lucia Lonetti, Annalisa Suh, Pann-Ghill McCubrey, James A. Cocco, Lucio Oncotarget Research Paper Through the years, different studies showed the involvement of Protein Kinase C (PKC) in cell cycle control, in particular during G1/S transition. Little is known about their role at G2/M checkpoint. In this study, using K562 human erythroleukemia cell line, we found a novel and specific mechanism through which the conventional isoform PKC⍺ positively affects Cyclin B1 modulating G2/M progression of cell cycle. Since the kinase activity of this PKC isoform was not necessary in this process, we demonstrated that PKC⍺, physically interacting with Cyclin B1, avoided its degradation and stimulated its nuclear import at mitosis. Moreover, the process resulted to be strictly connected with the increase in nuclear diacylglycerol levels (DAG) at G2/M checkpoint, due to the activity of nuclear Phospholipase C β1 (PLCβ1), the only PLC isoform mainly localized in the nucleus of K562 cells. Taken together, our findings indicated a novel DAG dependent mechanism able to regulate the G2/M progression of the cell cycle. Impact Journals LLC 2014-10-24 /pmc/articles/PMC4294327/ /pubmed/25362646 Text en Copyright: © 2014 Poli et al. http://creativecommons.org/licenses/by/2.5/ This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited |
spellingShingle | Research Paper Poli, Alessandro Ramazzotti, Giulia Matteucci, Alessandro Manzoli, Lucia Lonetti, Annalisa Suh, Pann-Ghill McCubrey, James A. Cocco, Lucio A novel DAG-dependent mechanism links PKCa and Cyclin B1 regulating cell cycle progression |
title | A novel DAG-dependent mechanism links PKCa and Cyclin B1 regulating cell cycle progression |
title_full | A novel DAG-dependent mechanism links PKCa and Cyclin B1 regulating cell cycle progression |
title_fullStr | A novel DAG-dependent mechanism links PKCa and Cyclin B1 regulating cell cycle progression |
title_full_unstemmed | A novel DAG-dependent mechanism links PKCa and Cyclin B1 regulating cell cycle progression |
title_short | A novel DAG-dependent mechanism links PKCa and Cyclin B1 regulating cell cycle progression |
title_sort | novel dag-dependent mechanism links pkca and cyclin b1 regulating cell cycle progression |
topic | Research Paper |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4294327/ https://www.ncbi.nlm.nih.gov/pubmed/25362646 |
work_keys_str_mv | AT polialessandro anoveldagdependentmechanismlinkspkcaandcyclinb1regulatingcellcycleprogression AT ramazzottigiulia anoveldagdependentmechanismlinkspkcaandcyclinb1regulatingcellcycleprogression AT matteuccialessandro anoveldagdependentmechanismlinkspkcaandcyclinb1regulatingcellcycleprogression AT manzolilucia anoveldagdependentmechanismlinkspkcaandcyclinb1regulatingcellcycleprogression AT lonettiannalisa anoveldagdependentmechanismlinkspkcaandcyclinb1regulatingcellcycleprogression AT suhpannghill anoveldagdependentmechanismlinkspkcaandcyclinb1regulatingcellcycleprogression AT mccubreyjamesa anoveldagdependentmechanismlinkspkcaandcyclinb1regulatingcellcycleprogression AT coccolucio anoveldagdependentmechanismlinkspkcaandcyclinb1regulatingcellcycleprogression AT polialessandro noveldagdependentmechanismlinkspkcaandcyclinb1regulatingcellcycleprogression AT ramazzottigiulia noveldagdependentmechanismlinkspkcaandcyclinb1regulatingcellcycleprogression AT matteuccialessandro noveldagdependentmechanismlinkspkcaandcyclinb1regulatingcellcycleprogression AT manzolilucia noveldagdependentmechanismlinkspkcaandcyclinb1regulatingcellcycleprogression AT lonettiannalisa noveldagdependentmechanismlinkspkcaandcyclinb1regulatingcellcycleprogression AT suhpannghill noveldagdependentmechanismlinkspkcaandcyclinb1regulatingcellcycleprogression AT mccubreyjamesa noveldagdependentmechanismlinkspkcaandcyclinb1regulatingcellcycleprogression AT coccolucio noveldagdependentmechanismlinkspkcaandcyclinb1regulatingcellcycleprogression |