Cargando…

Achieving sustained virologic response in hepatitis C: a systematic review of the clinical, economic and quality of life benefits

BACKGROUND: The goal of chronic hepatitis C treatment is to remove the virus to avoid progression of HCV-related disease. Sustained virologic response (SVR) is the most widely used efficacy endpoint in clinical studies of hepatitis C, and represents the eradication of HCV from the body. The aim of t...

Descripción completa

Detalles Bibliográficos
Autores principales: Smith-Palmer, Jayne, Cerri, Karin, Valentine, William
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2015
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4299677/
https://www.ncbi.nlm.nih.gov/pubmed/25596623
http://dx.doi.org/10.1186/s12879-015-0748-8
_version_ 1782353428785135616
author Smith-Palmer, Jayne
Cerri, Karin
Valentine, William
author_facet Smith-Palmer, Jayne
Cerri, Karin
Valentine, William
author_sort Smith-Palmer, Jayne
collection PubMed
description BACKGROUND: The goal of chronic hepatitis C treatment is to remove the virus to avoid progression of HCV-related disease. Sustained virologic response (SVR) is the most widely used efficacy endpoint in clinical studies of hepatitis C, and represents the eradication of HCV from the body. The aim of the current review was to examine the long-term clinical, economic and quality of life benefits associated with achieving SVR. METHODS: A systematic literature review was performed using the PubMed, EMBASE and Cochrane library databases to identify articles examining the clinical, economic and quality of life benefits associated with SVR, published in English language from 2002–2013. For inclusion studies were required to enroll ≥100 patients and to report clinical endpoints including hepatocellular carcinoma, overall- or liver-related mortality, or progression of disease/complications (e.g. portal hypertension, esophageal varices). Review of economic studies on cost/cost-effectiveness of achieving SVR were focused on studies assessing boceprevir/telaprevir plus pegIFN and ribavirin as this represents the current standard of care in several jurisdictions worldwide. Quality of life evidence was required to use validated quality of life instruments and provide a quantitative analysis of the impact of SVR versus no treatment or treatment failure. RESULTS: SVR is durable with late relapse rates over 4–5 year periods being in the range of 1–2%. Patients who achieve SVR frequently demonstrate some regression of fibrosis/cirrhosis and have a substantially reduced risk for hepatocellular carcinoma (relative risk [RR] 0.1–0.25), liver-related mortality (RR 0.03–0.2) and overall mortality (RR 0.1–0.3) in comparison with no treatment or treatment failure. In the 5 years post-treatment, medical costs for patients achieving SVR are 13-fold lower than patients not achieving SVR. Patients who achieve SVR also have health state utility values that are 0.05 to 0.31 higher than non-responders to treatment. CONCLUSIONS: SVR represents the fundamental goal of antiviral treatment for patients infected with chronic HCV, so as to reduce risk of liver disease progression. Achievement of SVR has implications beyond those of clearing viral infection; it is associated with improved long-term clinical outcomes, economic benefits and improved health-related quality of life. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s12879-015-0748-8) contains supplementary material, which is available to authorized users.
format Online
Article
Text
id pubmed-4299677
institution National Center for Biotechnology Information
language English
publishDate 2015
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-42996772015-01-21 Achieving sustained virologic response in hepatitis C: a systematic review of the clinical, economic and quality of life benefits Smith-Palmer, Jayne Cerri, Karin Valentine, William BMC Infect Dis Research Article BACKGROUND: The goal of chronic hepatitis C treatment is to remove the virus to avoid progression of HCV-related disease. Sustained virologic response (SVR) is the most widely used efficacy endpoint in clinical studies of hepatitis C, and represents the eradication of HCV from the body. The aim of the current review was to examine the long-term clinical, economic and quality of life benefits associated with achieving SVR. METHODS: A systematic literature review was performed using the PubMed, EMBASE and Cochrane library databases to identify articles examining the clinical, economic and quality of life benefits associated with SVR, published in English language from 2002–2013. For inclusion studies were required to enroll ≥100 patients and to report clinical endpoints including hepatocellular carcinoma, overall- or liver-related mortality, or progression of disease/complications (e.g. portal hypertension, esophageal varices). Review of economic studies on cost/cost-effectiveness of achieving SVR were focused on studies assessing boceprevir/telaprevir plus pegIFN and ribavirin as this represents the current standard of care in several jurisdictions worldwide. Quality of life evidence was required to use validated quality of life instruments and provide a quantitative analysis of the impact of SVR versus no treatment or treatment failure. RESULTS: SVR is durable with late relapse rates over 4–5 year periods being in the range of 1–2%. Patients who achieve SVR frequently demonstrate some regression of fibrosis/cirrhosis and have a substantially reduced risk for hepatocellular carcinoma (relative risk [RR] 0.1–0.25), liver-related mortality (RR 0.03–0.2) and overall mortality (RR 0.1–0.3) in comparison with no treatment or treatment failure. In the 5 years post-treatment, medical costs for patients achieving SVR are 13-fold lower than patients not achieving SVR. Patients who achieve SVR also have health state utility values that are 0.05 to 0.31 higher than non-responders to treatment. CONCLUSIONS: SVR represents the fundamental goal of antiviral treatment for patients infected with chronic HCV, so as to reduce risk of liver disease progression. Achievement of SVR has implications beyond those of clearing viral infection; it is associated with improved long-term clinical outcomes, economic benefits and improved health-related quality of life. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s12879-015-0748-8) contains supplementary material, which is available to authorized users. BioMed Central 2015-01-17 /pmc/articles/PMC4299677/ /pubmed/25596623 http://dx.doi.org/10.1186/s12879-015-0748-8 Text en © Smith-Palmer et al.; licensee BioMed Central. 2015 This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly credited. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research Article
Smith-Palmer, Jayne
Cerri, Karin
Valentine, William
Achieving sustained virologic response in hepatitis C: a systematic review of the clinical, economic and quality of life benefits
title Achieving sustained virologic response in hepatitis C: a systematic review of the clinical, economic and quality of life benefits
title_full Achieving sustained virologic response in hepatitis C: a systematic review of the clinical, economic and quality of life benefits
title_fullStr Achieving sustained virologic response in hepatitis C: a systematic review of the clinical, economic and quality of life benefits
title_full_unstemmed Achieving sustained virologic response in hepatitis C: a systematic review of the clinical, economic and quality of life benefits
title_short Achieving sustained virologic response in hepatitis C: a systematic review of the clinical, economic and quality of life benefits
title_sort achieving sustained virologic response in hepatitis c: a systematic review of the clinical, economic and quality of life benefits
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4299677/
https://www.ncbi.nlm.nih.gov/pubmed/25596623
http://dx.doi.org/10.1186/s12879-015-0748-8
work_keys_str_mv AT smithpalmerjayne achievingsustainedvirologicresponseinhepatitiscasystematicreviewoftheclinicaleconomicandqualityoflifebenefits
AT cerrikarin achievingsustainedvirologicresponseinhepatitiscasystematicreviewoftheclinicaleconomicandqualityoflifebenefits
AT valentinewilliam achievingsustainedvirologicresponseinhepatitiscasystematicreviewoftheclinicaleconomicandqualityoflifebenefits