Cargando…
Reviews: Rapid! Rapid! Rapid! …and systematic
| Autores principales: | , |
|---|---|
| Formato: | Online Artículo Texto |
| Lenguaje: | English |
| Publicado: |
BioMed Central
2015
|
| Materias: | |
| Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4320433/ https://www.ncbi.nlm.nih.gov/pubmed/25589399 http://dx.doi.org/10.1186/2046-4053-4-4 |
| _version_ | 1782356111939076096 |
|---|---|
| author | Schünemann, Holger J Moja, Lorenzo |
| author_facet | Schünemann, Holger J Moja, Lorenzo |
| author_sort | Schünemann, Holger J |
| collection | PubMed |
| description | |
| format | Online Article Text |
| id | pubmed-4320433 |
| institution | National Center for Biotechnology Information |
| language | English |
| publishDate | 2015 |
| publisher | BioMed Central |
| record_format | MEDLINE/PubMed |
| spelling | pubmed-43204332015-02-08 Reviews: Rapid! Rapid! Rapid! …and systematic Schünemann, Holger J Moja, Lorenzo Syst Rev Editorial BioMed Central 2015-01-14 /pmc/articles/PMC4320433/ /pubmed/25589399 http://dx.doi.org/10.1186/2046-4053-4-4 Text en © Schünemann and Moja; licensee BioMed Central. 2015 This article is published under license to BioMed Central Ltd. This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly credited. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
| spellingShingle | Editorial Schünemann, Holger J Moja, Lorenzo Reviews: Rapid! Rapid! Rapid! …and systematic |
| title | Reviews: Rapid! Rapid! Rapid! …and systematic |
| title_full | Reviews: Rapid! Rapid! Rapid! …and systematic |
| title_fullStr | Reviews: Rapid! Rapid! Rapid! …and systematic |
| title_full_unstemmed | Reviews: Rapid! Rapid! Rapid! …and systematic |
| title_short | Reviews: Rapid! Rapid! Rapid! …and systematic |
| title_sort | reviews: rapid! rapid! rapid! …and systematic |
| topic | Editorial |
| url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4320433/ https://www.ncbi.nlm.nih.gov/pubmed/25589399 http://dx.doi.org/10.1186/2046-4053-4-4 |
| work_keys_str_mv | AT schunemannholgerj reviewsrapidrapidrapidandsystematic AT mojalorenzo reviewsrapidrapidrapidandsystematic |