Cargando…

Effects of Ethnic Attributes on the Quality of Family Planning Services in Lima, Peru: A Randomized Crossover Trial

Most studies reporting ethnic disparities in the quality of healthcare come from developed countries and rely on observational methods. We conducted the first experimental study to evaluate whether health providers in Peru provide differential quality of care for family planning services, based on t...

Descripción completa

Detalles Bibliográficos
Autores principales: Planas, Maria-Elena, García, Patricia J., Bustelo, Monserrat, Carcamo, Cesar P., Martinez, Sebastian, Nopo, Hugo, Rodriguez, Julio, Merino, Maria-Fernanda, Morrison, Andrew
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Public Library of Science 2015
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4324646/
https://www.ncbi.nlm.nih.gov/pubmed/25671664
http://dx.doi.org/10.1371/journal.pone.0115274
_version_ 1782356704221986816
author Planas, Maria-Elena
García, Patricia J.
Bustelo, Monserrat
Carcamo, Cesar P.
Martinez, Sebastian
Nopo, Hugo
Rodriguez, Julio
Merino, Maria-Fernanda
Morrison, Andrew
author_facet Planas, Maria-Elena
García, Patricia J.
Bustelo, Monserrat
Carcamo, Cesar P.
Martinez, Sebastian
Nopo, Hugo
Rodriguez, Julio
Merino, Maria-Fernanda
Morrison, Andrew
author_sort Planas, Maria-Elena
collection PubMed
description Most studies reporting ethnic disparities in the quality of healthcare come from developed countries and rely on observational methods. We conducted the first experimental study to evaluate whether health providers in Peru provide differential quality of care for family planning services, based on the indigenous or mestizo (mixed ethnoracial ancestry) profile of the patient. In a crossover randomized controlled trial conducted in 2012, a sample of 351 out of the 408 public health establishments in Metropolitan Lima, Peru were randomly assigned to receive unannounced simulated patients enacting indigenous and mestizo profiles (sequence-1) or mestizo and then indigenous profiles (sequence-2), with a five week wash-out period. Both ethnic profiles used the same scripted scenario for seeking contraceptive advice but had distinctive cultural attributes such as clothing, styling of hair, make-up, accessories, posture and patterns of movement and speech. Our primary outcome measure of quality of care is the proportion of technical tasks performed by providers, as established by Peruvian family planning clinical guidelines. Providers and data analysts were kept blinded to the allocation. We found a non-significant mean difference of -0·7% (p = 0·23) between ethnic profiles in the percentage of technical tasks performed by providers. However we report large deficiencies in the compliance with quality standards of care for both profiles. Differential provider behaviour based on the patient's ethnic profiles compared in the study did not contribute to deficiencies in family planning outcomes observed. The study highlights the need to explore other determinants for poor compliance with quality standards, including demand and supply side factors, and calls for interventions to improve the quality of care for family planning services in Metropolitan Lima.
format Online
Article
Text
id pubmed-4324646
institution National Center for Biotechnology Information
language English
publishDate 2015
publisher Public Library of Science
record_format MEDLINE/PubMed
spelling pubmed-43246462015-02-18 Effects of Ethnic Attributes on the Quality of Family Planning Services in Lima, Peru: A Randomized Crossover Trial Planas, Maria-Elena García, Patricia J. Bustelo, Monserrat Carcamo, Cesar P. Martinez, Sebastian Nopo, Hugo Rodriguez, Julio Merino, Maria-Fernanda Morrison, Andrew PLoS One Research Article Most studies reporting ethnic disparities in the quality of healthcare come from developed countries and rely on observational methods. We conducted the first experimental study to evaluate whether health providers in Peru provide differential quality of care for family planning services, based on the indigenous or mestizo (mixed ethnoracial ancestry) profile of the patient. In a crossover randomized controlled trial conducted in 2012, a sample of 351 out of the 408 public health establishments in Metropolitan Lima, Peru were randomly assigned to receive unannounced simulated patients enacting indigenous and mestizo profiles (sequence-1) or mestizo and then indigenous profiles (sequence-2), with a five week wash-out period. Both ethnic profiles used the same scripted scenario for seeking contraceptive advice but had distinctive cultural attributes such as clothing, styling of hair, make-up, accessories, posture and patterns of movement and speech. Our primary outcome measure of quality of care is the proportion of technical tasks performed by providers, as established by Peruvian family planning clinical guidelines. Providers and data analysts were kept blinded to the allocation. We found a non-significant mean difference of -0·7% (p = 0·23) between ethnic profiles in the percentage of technical tasks performed by providers. However we report large deficiencies in the compliance with quality standards of care for both profiles. Differential provider behaviour based on the patient's ethnic profiles compared in the study did not contribute to deficiencies in family planning outcomes observed. The study highlights the need to explore other determinants for poor compliance with quality standards, including demand and supply side factors, and calls for interventions to improve the quality of care for family planning services in Metropolitan Lima. Public Library of Science 2015-02-11 /pmc/articles/PMC4324646/ /pubmed/25671664 http://dx.doi.org/10.1371/journal.pone.0115274 Text en © 2015 Planas et al http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are properly credited.
spellingShingle Research Article
Planas, Maria-Elena
García, Patricia J.
Bustelo, Monserrat
Carcamo, Cesar P.
Martinez, Sebastian
Nopo, Hugo
Rodriguez, Julio
Merino, Maria-Fernanda
Morrison, Andrew
Effects of Ethnic Attributes on the Quality of Family Planning Services in Lima, Peru: A Randomized Crossover Trial
title Effects of Ethnic Attributes on the Quality of Family Planning Services in Lima, Peru: A Randomized Crossover Trial
title_full Effects of Ethnic Attributes on the Quality of Family Planning Services in Lima, Peru: A Randomized Crossover Trial
title_fullStr Effects of Ethnic Attributes on the Quality of Family Planning Services in Lima, Peru: A Randomized Crossover Trial
title_full_unstemmed Effects of Ethnic Attributes on the Quality of Family Planning Services in Lima, Peru: A Randomized Crossover Trial
title_short Effects of Ethnic Attributes on the Quality of Family Planning Services in Lima, Peru: A Randomized Crossover Trial
title_sort effects of ethnic attributes on the quality of family planning services in lima, peru: a randomized crossover trial
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4324646/
https://www.ncbi.nlm.nih.gov/pubmed/25671664
http://dx.doi.org/10.1371/journal.pone.0115274
work_keys_str_mv AT planasmariaelena effectsofethnicattributesonthequalityoffamilyplanningservicesinlimaperuarandomizedcrossovertrial
AT garciapatriciaj effectsofethnicattributesonthequalityoffamilyplanningservicesinlimaperuarandomizedcrossovertrial
AT bustelomonserrat effectsofethnicattributesonthequalityoffamilyplanningservicesinlimaperuarandomizedcrossovertrial
AT carcamocesarp effectsofethnicattributesonthequalityoffamilyplanningservicesinlimaperuarandomizedcrossovertrial
AT martinezsebastian effectsofethnicattributesonthequalityoffamilyplanningservicesinlimaperuarandomizedcrossovertrial
AT nopohugo effectsofethnicattributesonthequalityoffamilyplanningservicesinlimaperuarandomizedcrossovertrial
AT rodriguezjulio effectsofethnicattributesonthequalityoffamilyplanningservicesinlimaperuarandomizedcrossovertrial
AT merinomariafernanda effectsofethnicattributesonthequalityoffamilyplanningservicesinlimaperuarandomizedcrossovertrial
AT morrisonandrew effectsofethnicattributesonthequalityoffamilyplanningservicesinlimaperuarandomizedcrossovertrial