Cargando…
Further evidence for causal FAM20A mutations and first case of amelogenesis imperfecta and gingival hyperplasia syndrome in Morocco: a case report
BACKGROUND: Amelogenesis imperfecta represents a group of developmental conditions, clinically and genetically heterogeneous, that affect the structure and clinical appearance of enamel. Amelogenesis imperfecta occurred as an isolated trait or as part of a genetic syndrome. Recently, disease-causing...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2015
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4327795/ https://www.ncbi.nlm.nih.gov/pubmed/25636655 http://dx.doi.org/10.1186/1472-6831-15-14 |
_version_ | 1782357156181311488 |
---|---|
author | Cherkaoui Jaouad, Imane El Alloussi, Mustapha Chafai El alaoui, Siham Laarabi, Fatima Zahra Lyahyai, Jaber Sefiani, Abdelaziz |
author_facet | Cherkaoui Jaouad, Imane El Alloussi, Mustapha Chafai El alaoui, Siham Laarabi, Fatima Zahra Lyahyai, Jaber Sefiani, Abdelaziz |
author_sort | Cherkaoui Jaouad, Imane |
collection | PubMed |
description | BACKGROUND: Amelogenesis imperfecta represents a group of developmental conditions, clinically and genetically heterogeneous, that affect the structure and clinical appearance of enamel. Amelogenesis imperfecta occurred as an isolated trait or as part of a genetic syndrome. Recently, disease-causing mutations in the FAM20A gene were identified, in families with an autosomal recessive syndrome associating amelogenesis imperfecta and gingival fibromatosis. CASE PRESENTATION: We report, the first description of a Moroccan patient with amelogenesis imperfecta and gingival fibromatosis, in whom we performed Sanger sequencing of the entire coding sequence of FAM20A and identified a homozygous mutation in the FAM20A gene (c.34_35delCT), already reported in a family with this syndrome. CONCLUSION: Our finding confirms that the mutations of FAM20A gene are causative for amelogenesis imperfecta and gingival fibromatosis and underlines the recurrent character of the c.34_35delCT in two different ethnic groups. |
format | Online Article Text |
id | pubmed-4327795 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2015 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-43277952015-02-14 Further evidence for causal FAM20A mutations and first case of amelogenesis imperfecta and gingival hyperplasia syndrome in Morocco: a case report Cherkaoui Jaouad, Imane El Alloussi, Mustapha Chafai El alaoui, Siham Laarabi, Fatima Zahra Lyahyai, Jaber Sefiani, Abdelaziz BMC Oral Health Case Report BACKGROUND: Amelogenesis imperfecta represents a group of developmental conditions, clinically and genetically heterogeneous, that affect the structure and clinical appearance of enamel. Amelogenesis imperfecta occurred as an isolated trait or as part of a genetic syndrome. Recently, disease-causing mutations in the FAM20A gene were identified, in families with an autosomal recessive syndrome associating amelogenesis imperfecta and gingival fibromatosis. CASE PRESENTATION: We report, the first description of a Moroccan patient with amelogenesis imperfecta and gingival fibromatosis, in whom we performed Sanger sequencing of the entire coding sequence of FAM20A and identified a homozygous mutation in the FAM20A gene (c.34_35delCT), already reported in a family with this syndrome. CONCLUSION: Our finding confirms that the mutations of FAM20A gene are causative for amelogenesis imperfecta and gingival fibromatosis and underlines the recurrent character of the c.34_35delCT in two different ethnic groups. BioMed Central 2015-01-30 /pmc/articles/PMC4327795/ /pubmed/25636655 http://dx.doi.org/10.1186/1472-6831-15-14 Text en © Cherkaoui Jaouad et al.; licensee BioMed Central. 2015 This article is published under license to BioMed Central Ltd. This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly credited. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Case Report Cherkaoui Jaouad, Imane El Alloussi, Mustapha Chafai El alaoui, Siham Laarabi, Fatima Zahra Lyahyai, Jaber Sefiani, Abdelaziz Further evidence for causal FAM20A mutations and first case of amelogenesis imperfecta and gingival hyperplasia syndrome in Morocco: a case report |
title | Further evidence for causal FAM20A mutations and first case of amelogenesis imperfecta and gingival hyperplasia syndrome in Morocco: a case report |
title_full | Further evidence for causal FAM20A mutations and first case of amelogenesis imperfecta and gingival hyperplasia syndrome in Morocco: a case report |
title_fullStr | Further evidence for causal FAM20A mutations and first case of amelogenesis imperfecta and gingival hyperplasia syndrome in Morocco: a case report |
title_full_unstemmed | Further evidence for causal FAM20A mutations and first case of amelogenesis imperfecta and gingival hyperplasia syndrome in Morocco: a case report |
title_short | Further evidence for causal FAM20A mutations and first case of amelogenesis imperfecta and gingival hyperplasia syndrome in Morocco: a case report |
title_sort | further evidence for causal fam20a mutations and first case of amelogenesis imperfecta and gingival hyperplasia syndrome in morocco: a case report |
topic | Case Report |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4327795/ https://www.ncbi.nlm.nih.gov/pubmed/25636655 http://dx.doi.org/10.1186/1472-6831-15-14 |
work_keys_str_mv | AT cherkaouijaouadimane furtherevidenceforcausalfam20amutationsandfirstcaseofamelogenesisimperfectaandgingivalhyperplasiasyndromeinmoroccoacasereport AT elalloussimustapha furtherevidenceforcausalfam20amutationsandfirstcaseofamelogenesisimperfectaandgingivalhyperplasiasyndromeinmoroccoacasereport AT chafaielalaouisiham furtherevidenceforcausalfam20amutationsandfirstcaseofamelogenesisimperfectaandgingivalhyperplasiasyndromeinmoroccoacasereport AT laarabifatimazahra furtherevidenceforcausalfam20amutationsandfirstcaseofamelogenesisimperfectaandgingivalhyperplasiasyndromeinmoroccoacasereport AT lyahyaijaber furtherevidenceforcausalfam20amutationsandfirstcaseofamelogenesisimperfectaandgingivalhyperplasiasyndromeinmoroccoacasereport AT sefianiabdelaziz furtherevidenceforcausalfam20amutationsandfirstcaseofamelogenesisimperfectaandgingivalhyperplasiasyndromeinmoroccoacasereport |