Cargando…

Further evidence for causal FAM20A mutations and first case of amelogenesis imperfecta and gingival hyperplasia syndrome in Morocco: a case report

BACKGROUND: Amelogenesis imperfecta represents a group of developmental conditions, clinically and genetically heterogeneous, that affect the structure and clinical appearance of enamel. Amelogenesis imperfecta occurred as an isolated trait or as part of a genetic syndrome. Recently, disease-causing...

Descripción completa

Detalles Bibliográficos
Autores principales: Cherkaoui Jaouad, Imane, El Alloussi, Mustapha, Chafai El alaoui, Siham, Laarabi, Fatima Zahra, Lyahyai, Jaber, Sefiani, Abdelaziz
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2015
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4327795/
https://www.ncbi.nlm.nih.gov/pubmed/25636655
http://dx.doi.org/10.1186/1472-6831-15-14
_version_ 1782357156181311488
author Cherkaoui Jaouad, Imane
El Alloussi, Mustapha
Chafai El alaoui, Siham
Laarabi, Fatima Zahra
Lyahyai, Jaber
Sefiani, Abdelaziz
author_facet Cherkaoui Jaouad, Imane
El Alloussi, Mustapha
Chafai El alaoui, Siham
Laarabi, Fatima Zahra
Lyahyai, Jaber
Sefiani, Abdelaziz
author_sort Cherkaoui Jaouad, Imane
collection PubMed
description BACKGROUND: Amelogenesis imperfecta represents a group of developmental conditions, clinically and genetically heterogeneous, that affect the structure and clinical appearance of enamel. Amelogenesis imperfecta occurred as an isolated trait or as part of a genetic syndrome. Recently, disease-causing mutations in the FAM20A gene were identified, in families with an autosomal recessive syndrome associating amelogenesis imperfecta and gingival fibromatosis. CASE PRESENTATION: We report, the first description of a Moroccan patient with amelogenesis imperfecta and gingival fibromatosis, in whom we performed Sanger sequencing of the entire coding sequence of FAM20A and identified a homozygous mutation in the FAM20A gene (c.34_35delCT), already reported in a family with this syndrome. CONCLUSION: Our finding confirms that the mutations of FAM20A gene are causative for amelogenesis imperfecta and gingival fibromatosis and underlines the recurrent character of the c.34_35delCT in two different ethnic groups.
format Online
Article
Text
id pubmed-4327795
institution National Center for Biotechnology Information
language English
publishDate 2015
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-43277952015-02-14 Further evidence for causal FAM20A mutations and first case of amelogenesis imperfecta and gingival hyperplasia syndrome in Morocco: a case report Cherkaoui Jaouad, Imane El Alloussi, Mustapha Chafai El alaoui, Siham Laarabi, Fatima Zahra Lyahyai, Jaber Sefiani, Abdelaziz BMC Oral Health Case Report BACKGROUND: Amelogenesis imperfecta represents a group of developmental conditions, clinically and genetically heterogeneous, that affect the structure and clinical appearance of enamel. Amelogenesis imperfecta occurred as an isolated trait or as part of a genetic syndrome. Recently, disease-causing mutations in the FAM20A gene were identified, in families with an autosomal recessive syndrome associating amelogenesis imperfecta and gingival fibromatosis. CASE PRESENTATION: We report, the first description of a Moroccan patient with amelogenesis imperfecta and gingival fibromatosis, in whom we performed Sanger sequencing of the entire coding sequence of FAM20A and identified a homozygous mutation in the FAM20A gene (c.34_35delCT), already reported in a family with this syndrome. CONCLUSION: Our finding confirms that the mutations of FAM20A gene are causative for amelogenesis imperfecta and gingival fibromatosis and underlines the recurrent character of the c.34_35delCT in two different ethnic groups. BioMed Central 2015-01-30 /pmc/articles/PMC4327795/ /pubmed/25636655 http://dx.doi.org/10.1186/1472-6831-15-14 Text en © Cherkaoui Jaouad et al.; licensee BioMed Central. 2015 This article is published under license to BioMed Central Ltd. This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly credited. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Case Report
Cherkaoui Jaouad, Imane
El Alloussi, Mustapha
Chafai El alaoui, Siham
Laarabi, Fatima Zahra
Lyahyai, Jaber
Sefiani, Abdelaziz
Further evidence for causal FAM20A mutations and first case of amelogenesis imperfecta and gingival hyperplasia syndrome in Morocco: a case report
title Further evidence for causal FAM20A mutations and first case of amelogenesis imperfecta and gingival hyperplasia syndrome in Morocco: a case report
title_full Further evidence for causal FAM20A mutations and first case of amelogenesis imperfecta and gingival hyperplasia syndrome in Morocco: a case report
title_fullStr Further evidence for causal FAM20A mutations and first case of amelogenesis imperfecta and gingival hyperplasia syndrome in Morocco: a case report
title_full_unstemmed Further evidence for causal FAM20A mutations and first case of amelogenesis imperfecta and gingival hyperplasia syndrome in Morocco: a case report
title_short Further evidence for causal FAM20A mutations and first case of amelogenesis imperfecta and gingival hyperplasia syndrome in Morocco: a case report
title_sort further evidence for causal fam20a mutations and first case of amelogenesis imperfecta and gingival hyperplasia syndrome in morocco: a case report
topic Case Report
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4327795/
https://www.ncbi.nlm.nih.gov/pubmed/25636655
http://dx.doi.org/10.1186/1472-6831-15-14
work_keys_str_mv AT cherkaouijaouadimane furtherevidenceforcausalfam20amutationsandfirstcaseofamelogenesisimperfectaandgingivalhyperplasiasyndromeinmoroccoacasereport
AT elalloussimustapha furtherevidenceforcausalfam20amutationsandfirstcaseofamelogenesisimperfectaandgingivalhyperplasiasyndromeinmoroccoacasereport
AT chafaielalaouisiham furtherevidenceforcausalfam20amutationsandfirstcaseofamelogenesisimperfectaandgingivalhyperplasiasyndromeinmoroccoacasereport
AT laarabifatimazahra furtherevidenceforcausalfam20amutationsandfirstcaseofamelogenesisimperfectaandgingivalhyperplasiasyndromeinmoroccoacasereport
AT lyahyaijaber furtherevidenceforcausalfam20amutationsandfirstcaseofamelogenesisimperfectaandgingivalhyperplasiasyndromeinmoroccoacasereport
AT sefianiabdelaziz furtherevidenceforcausalfam20amutationsandfirstcaseofamelogenesisimperfectaandgingivalhyperplasiasyndromeinmoroccoacasereport