Cargando…

Metastatic rhabdoid meningioma of the parotid – Mimicking primary salivary gland neoplasm

INTRODUCTION: Tumors involving the parotid are predominantly primary with metastatic lesions forming a miniscule population. Meningioma metastasizing to the parotid is extremely rare and hence can often be mistaken for the more common primary salivary gland neoplasms. PRESENTATION OF CASE: A 59-year...

Descripción completa

Detalles Bibliográficos
Autores principales: Parameshwaran Nair, Rajesh, Vinod, Sarma, Yashdeep, Nayal, Bhavna, Kaur Dil, Sumeet, Tripathi, Pradeep Kumar
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Elsevier 2014
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4334639/
https://www.ncbi.nlm.nih.gov/pubmed/25528037
http://dx.doi.org/10.1016/j.ijscr.2014.10.048
_version_ 1782358222738292736
author Parameshwaran Nair, Rajesh
Vinod
Sarma, Yashdeep
Nayal, Bhavna
Kaur Dil, Sumeet
Tripathi, Pradeep Kumar
author_facet Parameshwaran Nair, Rajesh
Vinod
Sarma, Yashdeep
Nayal, Bhavna
Kaur Dil, Sumeet
Tripathi, Pradeep Kumar
author_sort Parameshwaran Nair, Rajesh
collection PubMed
description INTRODUCTION: Tumors involving the parotid are predominantly primary with metastatic lesions forming a miniscule population. Meningioma metastasizing to the parotid is extremely rare and hence can often be mistaken for the more common primary salivary gland neoplasms. PRESENTATION OF CASE: A 59-year-old male presented with a swelling in the left parotid region. Fine needle aspiration cytology was suggestive of myoepithelial predominant pleomorphic adenoma. A superficial parotidectomy performed revealed a tumor composed of rhabdoid cells with abundant finely granular eosinophilic cytoplasm raising a possibility of myoepithelioma. Immunohistochemistry for myoepithelial markers was negative. A critical review elicited a history of surgical excision of a recurrent rhabdoid meningioma twice. A possibility of metastasis was considered and a second panel of immunomarkers demonstrated vimentin and epithelial membrane antigen positivity. Neuroimaging studies demonstrated a space occupying lesion in the frontal lobe suggestive of a recurrent/residual tumor. In view of the history, neuroradiology, histopathology and immunohistochemistry, a final diagnosis of metastatic rhabdoid meningioma to the parotid was rendered. DISCUSSION: Morphologically, metastatic rhabdoid meningioma may mimic a primary or metastatic carcinoma, melanoma and sarcoma. Accurate diagnosis can be made by careful clinical evaluation and histopathological examination of the tumor. These tumors are composed of rhabdomyoblast like cells with abundant eosinophilic cytoplasm. The present case demonstrated characteristic histopathological features confirmed by immunohistochemistry. CONCLUSION: Rhabdoid meningioma is an aggressive tumor with a high propensity to recur and metastasize. The present case highlights the importance of clinical, radiological and histopathological correlation to accurately diagnose these rare entities.
format Online
Article
Text
id pubmed-4334639
institution National Center for Biotechnology Information
language English
publishDate 2014
publisher Elsevier
record_format MEDLINE/PubMed
spelling pubmed-43346392015-03-03 Metastatic rhabdoid meningioma of the parotid – Mimicking primary salivary gland neoplasm Parameshwaran Nair, Rajesh Vinod Sarma, Yashdeep Nayal, Bhavna Kaur Dil, Sumeet Tripathi, Pradeep Kumar Int J Surg Case Rep Article INTRODUCTION: Tumors involving the parotid are predominantly primary with metastatic lesions forming a miniscule population. Meningioma metastasizing to the parotid is extremely rare and hence can often be mistaken for the more common primary salivary gland neoplasms. PRESENTATION OF CASE: A 59-year-old male presented with a swelling in the left parotid region. Fine needle aspiration cytology was suggestive of myoepithelial predominant pleomorphic adenoma. A superficial parotidectomy performed revealed a tumor composed of rhabdoid cells with abundant finely granular eosinophilic cytoplasm raising a possibility of myoepithelioma. Immunohistochemistry for myoepithelial markers was negative. A critical review elicited a history of surgical excision of a recurrent rhabdoid meningioma twice. A possibility of metastasis was considered and a second panel of immunomarkers demonstrated vimentin and epithelial membrane antigen positivity. Neuroimaging studies demonstrated a space occupying lesion in the frontal lobe suggestive of a recurrent/residual tumor. In view of the history, neuroradiology, histopathology and immunohistochemistry, a final diagnosis of metastatic rhabdoid meningioma to the parotid was rendered. DISCUSSION: Morphologically, metastatic rhabdoid meningioma may mimic a primary or metastatic carcinoma, melanoma and sarcoma. Accurate diagnosis can be made by careful clinical evaluation and histopathological examination of the tumor. These tumors are composed of rhabdomyoblast like cells with abundant eosinophilic cytoplasm. The present case demonstrated characteristic histopathological features confirmed by immunohistochemistry. CONCLUSION: Rhabdoid meningioma is an aggressive tumor with a high propensity to recur and metastasize. The present case highlights the importance of clinical, radiological and histopathological correlation to accurately diagnose these rare entities. Elsevier 2014-12-03 /pmc/articles/PMC4334639/ /pubmed/25528037 http://dx.doi.org/10.1016/j.ijscr.2014.10.048 Text en © 2014 The Authors http://creativecommons.org/licenses/by-nc-nd/3.0/ This is an open access article under the CC BY-NC-ND license (http://creativecommons.org/licenses/by-nc-nd/3.0/).
spellingShingle Article
Parameshwaran Nair, Rajesh
Vinod
Sarma, Yashdeep
Nayal, Bhavna
Kaur Dil, Sumeet
Tripathi, Pradeep Kumar
Metastatic rhabdoid meningioma of the parotid – Mimicking primary salivary gland neoplasm
title Metastatic rhabdoid meningioma of the parotid – Mimicking primary salivary gland neoplasm
title_full Metastatic rhabdoid meningioma of the parotid – Mimicking primary salivary gland neoplasm
title_fullStr Metastatic rhabdoid meningioma of the parotid – Mimicking primary salivary gland neoplasm
title_full_unstemmed Metastatic rhabdoid meningioma of the parotid – Mimicking primary salivary gland neoplasm
title_short Metastatic rhabdoid meningioma of the parotid – Mimicking primary salivary gland neoplasm
title_sort metastatic rhabdoid meningioma of the parotid – mimicking primary salivary gland neoplasm
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4334639/
https://www.ncbi.nlm.nih.gov/pubmed/25528037
http://dx.doi.org/10.1016/j.ijscr.2014.10.048
work_keys_str_mv AT parameshwarannairrajesh metastaticrhabdoidmeningiomaoftheparotidmimickingprimarysalivaryglandneoplasm
AT vinod metastaticrhabdoidmeningiomaoftheparotidmimickingprimarysalivaryglandneoplasm
AT sarmayashdeep metastaticrhabdoidmeningiomaoftheparotidmimickingprimarysalivaryglandneoplasm
AT nayalbhavna metastaticrhabdoidmeningiomaoftheparotidmimickingprimarysalivaryglandneoplasm
AT kaurdilsumeet metastaticrhabdoidmeningiomaoftheparotidmimickingprimarysalivaryglandneoplasm
AT tripathipradeepkumar metastaticrhabdoidmeningiomaoftheparotidmimickingprimarysalivaryglandneoplasm