Cargando…
Metastatic rhabdoid meningioma of the parotid – Mimicking primary salivary gland neoplasm
INTRODUCTION: Tumors involving the parotid are predominantly primary with metastatic lesions forming a miniscule population. Meningioma metastasizing to the parotid is extremely rare and hence can often be mistaken for the more common primary salivary gland neoplasms. PRESENTATION OF CASE: A 59-year...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Elsevier
2014
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4334639/ https://www.ncbi.nlm.nih.gov/pubmed/25528037 http://dx.doi.org/10.1016/j.ijscr.2014.10.048 |
_version_ | 1782358222738292736 |
---|---|
author | Parameshwaran Nair, Rajesh Vinod Sarma, Yashdeep Nayal, Bhavna Kaur Dil, Sumeet Tripathi, Pradeep Kumar |
author_facet | Parameshwaran Nair, Rajesh Vinod Sarma, Yashdeep Nayal, Bhavna Kaur Dil, Sumeet Tripathi, Pradeep Kumar |
author_sort | Parameshwaran Nair, Rajesh |
collection | PubMed |
description | INTRODUCTION: Tumors involving the parotid are predominantly primary with metastatic lesions forming a miniscule population. Meningioma metastasizing to the parotid is extremely rare and hence can often be mistaken for the more common primary salivary gland neoplasms. PRESENTATION OF CASE: A 59-year-old male presented with a swelling in the left parotid region. Fine needle aspiration cytology was suggestive of myoepithelial predominant pleomorphic adenoma. A superficial parotidectomy performed revealed a tumor composed of rhabdoid cells with abundant finely granular eosinophilic cytoplasm raising a possibility of myoepithelioma. Immunohistochemistry for myoepithelial markers was negative. A critical review elicited a history of surgical excision of a recurrent rhabdoid meningioma twice. A possibility of metastasis was considered and a second panel of immunomarkers demonstrated vimentin and epithelial membrane antigen positivity. Neuroimaging studies demonstrated a space occupying lesion in the frontal lobe suggestive of a recurrent/residual tumor. In view of the history, neuroradiology, histopathology and immunohistochemistry, a final diagnosis of metastatic rhabdoid meningioma to the parotid was rendered. DISCUSSION: Morphologically, metastatic rhabdoid meningioma may mimic a primary or metastatic carcinoma, melanoma and sarcoma. Accurate diagnosis can be made by careful clinical evaluation and histopathological examination of the tumor. These tumors are composed of rhabdomyoblast like cells with abundant eosinophilic cytoplasm. The present case demonstrated characteristic histopathological features confirmed by immunohistochemistry. CONCLUSION: Rhabdoid meningioma is an aggressive tumor with a high propensity to recur and metastasize. The present case highlights the importance of clinical, radiological and histopathological correlation to accurately diagnose these rare entities. |
format | Online Article Text |
id | pubmed-4334639 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2014 |
publisher | Elsevier |
record_format | MEDLINE/PubMed |
spelling | pubmed-43346392015-03-03 Metastatic rhabdoid meningioma of the parotid – Mimicking primary salivary gland neoplasm Parameshwaran Nair, Rajesh Vinod Sarma, Yashdeep Nayal, Bhavna Kaur Dil, Sumeet Tripathi, Pradeep Kumar Int J Surg Case Rep Article INTRODUCTION: Tumors involving the parotid are predominantly primary with metastatic lesions forming a miniscule population. Meningioma metastasizing to the parotid is extremely rare and hence can often be mistaken for the more common primary salivary gland neoplasms. PRESENTATION OF CASE: A 59-year-old male presented with a swelling in the left parotid region. Fine needle aspiration cytology was suggestive of myoepithelial predominant pleomorphic adenoma. A superficial parotidectomy performed revealed a tumor composed of rhabdoid cells with abundant finely granular eosinophilic cytoplasm raising a possibility of myoepithelioma. Immunohistochemistry for myoepithelial markers was negative. A critical review elicited a history of surgical excision of a recurrent rhabdoid meningioma twice. A possibility of metastasis was considered and a second panel of immunomarkers demonstrated vimentin and epithelial membrane antigen positivity. Neuroimaging studies demonstrated a space occupying lesion in the frontal lobe suggestive of a recurrent/residual tumor. In view of the history, neuroradiology, histopathology and immunohistochemistry, a final diagnosis of metastatic rhabdoid meningioma to the parotid was rendered. DISCUSSION: Morphologically, metastatic rhabdoid meningioma may mimic a primary or metastatic carcinoma, melanoma and sarcoma. Accurate diagnosis can be made by careful clinical evaluation and histopathological examination of the tumor. These tumors are composed of rhabdomyoblast like cells with abundant eosinophilic cytoplasm. The present case demonstrated characteristic histopathological features confirmed by immunohistochemistry. CONCLUSION: Rhabdoid meningioma is an aggressive tumor with a high propensity to recur and metastasize. The present case highlights the importance of clinical, radiological and histopathological correlation to accurately diagnose these rare entities. Elsevier 2014-12-03 /pmc/articles/PMC4334639/ /pubmed/25528037 http://dx.doi.org/10.1016/j.ijscr.2014.10.048 Text en © 2014 The Authors http://creativecommons.org/licenses/by-nc-nd/3.0/ This is an open access article under the CC BY-NC-ND license (http://creativecommons.org/licenses/by-nc-nd/3.0/). |
spellingShingle | Article Parameshwaran Nair, Rajesh Vinod Sarma, Yashdeep Nayal, Bhavna Kaur Dil, Sumeet Tripathi, Pradeep Kumar Metastatic rhabdoid meningioma of the parotid – Mimicking primary salivary gland neoplasm |
title | Metastatic rhabdoid meningioma of the parotid – Mimicking primary salivary gland neoplasm |
title_full | Metastatic rhabdoid meningioma of the parotid – Mimicking primary salivary gland neoplasm |
title_fullStr | Metastatic rhabdoid meningioma of the parotid – Mimicking primary salivary gland neoplasm |
title_full_unstemmed | Metastatic rhabdoid meningioma of the parotid – Mimicking primary salivary gland neoplasm |
title_short | Metastatic rhabdoid meningioma of the parotid – Mimicking primary salivary gland neoplasm |
title_sort | metastatic rhabdoid meningioma of the parotid – mimicking primary salivary gland neoplasm |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4334639/ https://www.ncbi.nlm.nih.gov/pubmed/25528037 http://dx.doi.org/10.1016/j.ijscr.2014.10.048 |
work_keys_str_mv | AT parameshwarannairrajesh metastaticrhabdoidmeningiomaoftheparotidmimickingprimarysalivaryglandneoplasm AT vinod metastaticrhabdoidmeningiomaoftheparotidmimickingprimarysalivaryglandneoplasm AT sarmayashdeep metastaticrhabdoidmeningiomaoftheparotidmimickingprimarysalivaryglandneoplasm AT nayalbhavna metastaticrhabdoidmeningiomaoftheparotidmimickingprimarysalivaryglandneoplasm AT kaurdilsumeet metastaticrhabdoidmeningiomaoftheparotidmimickingprimarysalivaryglandneoplasm AT tripathipradeepkumar metastaticrhabdoidmeningiomaoftheparotidmimickingprimarysalivaryglandneoplasm |