Cargando…
A Transcriptome Derived Female-Specific Marker from the Invasive Western Mosquitofish (Gambusia affinis)
Sex-specific markers are a prerequisite for understanding reproductive biology, genetic factors involved in sex differences, mechanisms of sex determination, and ultimately the evolution of sex chromosomes. The Western mosquitofish, Gambusia affinis, may be considered a model species for sex-chromos...
Autores principales: | , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Public Library of Science
2015
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4338254/ https://www.ncbi.nlm.nih.gov/pubmed/25707007 http://dx.doi.org/10.1371/journal.pone.0118214 |
_version_ | 1782481178449674240 |
---|---|
author | Lamatsch, Dunja K. Adolfsson, Sofia Senior, Alistair M. Christiansen, Guntram Pichler, Maria Ozaki, Yuichi Smeds, Linnea Schartl, Manfred Nakagawa, Shinichi |
author_facet | Lamatsch, Dunja K. Adolfsson, Sofia Senior, Alistair M. Christiansen, Guntram Pichler, Maria Ozaki, Yuichi Smeds, Linnea Schartl, Manfred Nakagawa, Shinichi |
author_sort | Lamatsch, Dunja K. |
collection | PubMed |
description | Sex-specific markers are a prerequisite for understanding reproductive biology, genetic factors involved in sex differences, mechanisms of sex determination, and ultimately the evolution of sex chromosomes. The Western mosquitofish, Gambusia affinis, may be considered a model species for sex-chromosome evolution, as it displays female heterogamety (ZW/ZZ), and is also ecologically interesting as a worldwide invasive species. Here, de novo RNA-sequencing on the gonads of sexually mature G. affinis was used to identify contigs that were highly transcribed in females but not in males (i.e., transcripts with ovary-specific expression). Subsequently, 129 primer pairs spanning 79 contigs were tested by PCR to identify sex-specific transcripts. Of those primer pairs, one female-specific DNA marker was identified, Sanger sequenced and subsequently validated in 115 fish. Sequence analyses revealed a high similarity between the identified sex-specific marker and the 3´ UTR of the aminomethyl transferase (amt) gene of the closely related platyfish (Xiphophorus maculatus). This is the first time that RNA-seq has been used to successfully characterize a sex-specific marker in a fish species in the absence of a genome map. Additionally, the identified sex-specific marker represents one of only a handful of such markers in fishes. |
format | Online Article Text |
id | pubmed-4338254 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2015 |
publisher | Public Library of Science |
record_format | MEDLINE/PubMed |
spelling | pubmed-43382542015-03-04 A Transcriptome Derived Female-Specific Marker from the Invasive Western Mosquitofish (Gambusia affinis) Lamatsch, Dunja K. Adolfsson, Sofia Senior, Alistair M. Christiansen, Guntram Pichler, Maria Ozaki, Yuichi Smeds, Linnea Schartl, Manfred Nakagawa, Shinichi PLoS One Research Article Sex-specific markers are a prerequisite for understanding reproductive biology, genetic factors involved in sex differences, mechanisms of sex determination, and ultimately the evolution of sex chromosomes. The Western mosquitofish, Gambusia affinis, may be considered a model species for sex-chromosome evolution, as it displays female heterogamety (ZW/ZZ), and is also ecologically interesting as a worldwide invasive species. Here, de novo RNA-sequencing on the gonads of sexually mature G. affinis was used to identify contigs that were highly transcribed in females but not in males (i.e., transcripts with ovary-specific expression). Subsequently, 129 primer pairs spanning 79 contigs were tested by PCR to identify sex-specific transcripts. Of those primer pairs, one female-specific DNA marker was identified, Sanger sequenced and subsequently validated in 115 fish. Sequence analyses revealed a high similarity between the identified sex-specific marker and the 3´ UTR of the aminomethyl transferase (amt) gene of the closely related platyfish (Xiphophorus maculatus). This is the first time that RNA-seq has been used to successfully characterize a sex-specific marker in a fish species in the absence of a genome map. Additionally, the identified sex-specific marker represents one of only a handful of such markers in fishes. Public Library of Science 2015-02-23 /pmc/articles/PMC4338254/ /pubmed/25707007 http://dx.doi.org/10.1371/journal.pone.0118214 Text en © 2015 Lamatsch et al http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are properly credited. |
spellingShingle | Research Article Lamatsch, Dunja K. Adolfsson, Sofia Senior, Alistair M. Christiansen, Guntram Pichler, Maria Ozaki, Yuichi Smeds, Linnea Schartl, Manfred Nakagawa, Shinichi A Transcriptome Derived Female-Specific Marker from the Invasive Western Mosquitofish (Gambusia affinis) |
title | A Transcriptome Derived Female-Specific Marker from the Invasive Western Mosquitofish (Gambusia affinis) |
title_full | A Transcriptome Derived Female-Specific Marker from the Invasive Western Mosquitofish (Gambusia affinis) |
title_fullStr | A Transcriptome Derived Female-Specific Marker from the Invasive Western Mosquitofish (Gambusia affinis) |
title_full_unstemmed | A Transcriptome Derived Female-Specific Marker from the Invasive Western Mosquitofish (Gambusia affinis) |
title_short | A Transcriptome Derived Female-Specific Marker from the Invasive Western Mosquitofish (Gambusia affinis) |
title_sort | transcriptome derived female-specific marker from the invasive western mosquitofish (gambusia affinis) |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4338254/ https://www.ncbi.nlm.nih.gov/pubmed/25707007 http://dx.doi.org/10.1371/journal.pone.0118214 |
work_keys_str_mv | AT lamatschdunjak atranscriptomederivedfemalespecificmarkerfromtheinvasivewesternmosquitofishgambusiaaffinis AT adolfssonsofia atranscriptomederivedfemalespecificmarkerfromtheinvasivewesternmosquitofishgambusiaaffinis AT senioralistairm atranscriptomederivedfemalespecificmarkerfromtheinvasivewesternmosquitofishgambusiaaffinis AT christiansenguntram atranscriptomederivedfemalespecificmarkerfromtheinvasivewesternmosquitofishgambusiaaffinis AT pichlermaria atranscriptomederivedfemalespecificmarkerfromtheinvasivewesternmosquitofishgambusiaaffinis AT ozakiyuichi atranscriptomederivedfemalespecificmarkerfromtheinvasivewesternmosquitofishgambusiaaffinis AT smedslinnea atranscriptomederivedfemalespecificmarkerfromtheinvasivewesternmosquitofishgambusiaaffinis AT schartlmanfred atranscriptomederivedfemalespecificmarkerfromtheinvasivewesternmosquitofishgambusiaaffinis AT nakagawashinichi atranscriptomederivedfemalespecificmarkerfromtheinvasivewesternmosquitofishgambusiaaffinis AT lamatschdunjak transcriptomederivedfemalespecificmarkerfromtheinvasivewesternmosquitofishgambusiaaffinis AT adolfssonsofia transcriptomederivedfemalespecificmarkerfromtheinvasivewesternmosquitofishgambusiaaffinis AT senioralistairm transcriptomederivedfemalespecificmarkerfromtheinvasivewesternmosquitofishgambusiaaffinis AT christiansenguntram transcriptomederivedfemalespecificmarkerfromtheinvasivewesternmosquitofishgambusiaaffinis AT pichlermaria transcriptomederivedfemalespecificmarkerfromtheinvasivewesternmosquitofishgambusiaaffinis AT ozakiyuichi transcriptomederivedfemalespecificmarkerfromtheinvasivewesternmosquitofishgambusiaaffinis AT smedslinnea transcriptomederivedfemalespecificmarkerfromtheinvasivewesternmosquitofishgambusiaaffinis AT schartlmanfred transcriptomederivedfemalespecificmarkerfromtheinvasivewesternmosquitofishgambusiaaffinis AT nakagawashinichi transcriptomederivedfemalespecificmarkerfromtheinvasivewesternmosquitofishgambusiaaffinis |