Cargando…

A Transcriptome Derived Female-Specific Marker from the Invasive Western Mosquitofish (Gambusia affinis)

Sex-specific markers are a prerequisite for understanding reproductive biology, genetic factors involved in sex differences, mechanisms of sex determination, and ultimately the evolution of sex chromosomes. The Western mosquitofish, Gambusia affinis, may be considered a model species for sex-chromos...

Descripción completa

Detalles Bibliográficos
Autores principales: Lamatsch, Dunja K., Adolfsson, Sofia, Senior, Alistair M., Christiansen, Guntram, Pichler, Maria, Ozaki, Yuichi, Smeds, Linnea, Schartl, Manfred, Nakagawa, Shinichi
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Public Library of Science 2015
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4338254/
https://www.ncbi.nlm.nih.gov/pubmed/25707007
http://dx.doi.org/10.1371/journal.pone.0118214
_version_ 1782481178449674240
author Lamatsch, Dunja K.
Adolfsson, Sofia
Senior, Alistair M.
Christiansen, Guntram
Pichler, Maria
Ozaki, Yuichi
Smeds, Linnea
Schartl, Manfred
Nakagawa, Shinichi
author_facet Lamatsch, Dunja K.
Adolfsson, Sofia
Senior, Alistair M.
Christiansen, Guntram
Pichler, Maria
Ozaki, Yuichi
Smeds, Linnea
Schartl, Manfred
Nakagawa, Shinichi
author_sort Lamatsch, Dunja K.
collection PubMed
description Sex-specific markers are a prerequisite for understanding reproductive biology, genetic factors involved in sex differences, mechanisms of sex determination, and ultimately the evolution of sex chromosomes. The Western mosquitofish, Gambusia affinis, may be considered a model species for sex-chromosome evolution, as it displays female heterogamety (ZW/ZZ), and is also ecologically interesting as a worldwide invasive species. Here, de novo RNA-sequencing on the gonads of sexually mature G. affinis was used to identify contigs that were highly transcribed in females but not in males (i.e., transcripts with ovary-specific expression). Subsequently, 129 primer pairs spanning 79 contigs were tested by PCR to identify sex-specific transcripts. Of those primer pairs, one female-specific DNA marker was identified, Sanger sequenced and subsequently validated in 115 fish. Sequence analyses revealed a high similarity between the identified sex-specific marker and the 3´ UTR of the aminomethyl transferase (amt) gene of the closely related platyfish (Xiphophorus maculatus). This is the first time that RNA-seq has been used to successfully characterize a sex-specific marker in a fish species in the absence of a genome map. Additionally, the identified sex-specific marker represents one of only a handful of such markers in fishes.
format Online
Article
Text
id pubmed-4338254
institution National Center for Biotechnology Information
language English
publishDate 2015
publisher Public Library of Science
record_format MEDLINE/PubMed
spelling pubmed-43382542015-03-04 A Transcriptome Derived Female-Specific Marker from the Invasive Western Mosquitofish (Gambusia affinis) Lamatsch, Dunja K. Adolfsson, Sofia Senior, Alistair M. Christiansen, Guntram Pichler, Maria Ozaki, Yuichi Smeds, Linnea Schartl, Manfred Nakagawa, Shinichi PLoS One Research Article Sex-specific markers are a prerequisite for understanding reproductive biology, genetic factors involved in sex differences, mechanisms of sex determination, and ultimately the evolution of sex chromosomes. The Western mosquitofish, Gambusia affinis, may be considered a model species for sex-chromosome evolution, as it displays female heterogamety (ZW/ZZ), and is also ecologically interesting as a worldwide invasive species. Here, de novo RNA-sequencing on the gonads of sexually mature G. affinis was used to identify contigs that were highly transcribed in females but not in males (i.e., transcripts with ovary-specific expression). Subsequently, 129 primer pairs spanning 79 contigs were tested by PCR to identify sex-specific transcripts. Of those primer pairs, one female-specific DNA marker was identified, Sanger sequenced and subsequently validated in 115 fish. Sequence analyses revealed a high similarity between the identified sex-specific marker and the 3´ UTR of the aminomethyl transferase (amt) gene of the closely related platyfish (Xiphophorus maculatus). This is the first time that RNA-seq has been used to successfully characterize a sex-specific marker in a fish species in the absence of a genome map. Additionally, the identified sex-specific marker represents one of only a handful of such markers in fishes. Public Library of Science 2015-02-23 /pmc/articles/PMC4338254/ /pubmed/25707007 http://dx.doi.org/10.1371/journal.pone.0118214 Text en © 2015 Lamatsch et al http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are properly credited.
spellingShingle Research Article
Lamatsch, Dunja K.
Adolfsson, Sofia
Senior, Alistair M.
Christiansen, Guntram
Pichler, Maria
Ozaki, Yuichi
Smeds, Linnea
Schartl, Manfred
Nakagawa, Shinichi
A Transcriptome Derived Female-Specific Marker from the Invasive Western Mosquitofish (Gambusia affinis)
title A Transcriptome Derived Female-Specific Marker from the Invasive Western Mosquitofish (Gambusia affinis)
title_full A Transcriptome Derived Female-Specific Marker from the Invasive Western Mosquitofish (Gambusia affinis)
title_fullStr A Transcriptome Derived Female-Specific Marker from the Invasive Western Mosquitofish (Gambusia affinis)
title_full_unstemmed A Transcriptome Derived Female-Specific Marker from the Invasive Western Mosquitofish (Gambusia affinis)
title_short A Transcriptome Derived Female-Specific Marker from the Invasive Western Mosquitofish (Gambusia affinis)
title_sort transcriptome derived female-specific marker from the invasive western mosquitofish (gambusia affinis)
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4338254/
https://www.ncbi.nlm.nih.gov/pubmed/25707007
http://dx.doi.org/10.1371/journal.pone.0118214
work_keys_str_mv AT lamatschdunjak atranscriptomederivedfemalespecificmarkerfromtheinvasivewesternmosquitofishgambusiaaffinis
AT adolfssonsofia atranscriptomederivedfemalespecificmarkerfromtheinvasivewesternmosquitofishgambusiaaffinis
AT senioralistairm atranscriptomederivedfemalespecificmarkerfromtheinvasivewesternmosquitofishgambusiaaffinis
AT christiansenguntram atranscriptomederivedfemalespecificmarkerfromtheinvasivewesternmosquitofishgambusiaaffinis
AT pichlermaria atranscriptomederivedfemalespecificmarkerfromtheinvasivewesternmosquitofishgambusiaaffinis
AT ozakiyuichi atranscriptomederivedfemalespecificmarkerfromtheinvasivewesternmosquitofishgambusiaaffinis
AT smedslinnea atranscriptomederivedfemalespecificmarkerfromtheinvasivewesternmosquitofishgambusiaaffinis
AT schartlmanfred atranscriptomederivedfemalespecificmarkerfromtheinvasivewesternmosquitofishgambusiaaffinis
AT nakagawashinichi atranscriptomederivedfemalespecificmarkerfromtheinvasivewesternmosquitofishgambusiaaffinis
AT lamatschdunjak transcriptomederivedfemalespecificmarkerfromtheinvasivewesternmosquitofishgambusiaaffinis
AT adolfssonsofia transcriptomederivedfemalespecificmarkerfromtheinvasivewesternmosquitofishgambusiaaffinis
AT senioralistairm transcriptomederivedfemalespecificmarkerfromtheinvasivewesternmosquitofishgambusiaaffinis
AT christiansenguntram transcriptomederivedfemalespecificmarkerfromtheinvasivewesternmosquitofishgambusiaaffinis
AT pichlermaria transcriptomederivedfemalespecificmarkerfromtheinvasivewesternmosquitofishgambusiaaffinis
AT ozakiyuichi transcriptomederivedfemalespecificmarkerfromtheinvasivewesternmosquitofishgambusiaaffinis
AT smedslinnea transcriptomederivedfemalespecificmarkerfromtheinvasivewesternmosquitofishgambusiaaffinis
AT schartlmanfred transcriptomederivedfemalespecificmarkerfromtheinvasivewesternmosquitofishgambusiaaffinis
AT nakagawashinichi transcriptomederivedfemalespecificmarkerfromtheinvasivewesternmosquitofishgambusiaaffinis