Cargando…

Performance enhancement in the workplace: why and when healthy individuals should disclose their reliance on pharmaceutical cognitive enhancers

The use of pharmaceuticals cognitive enhancers (PCE) has been stirring growing interest, not only in the scientific domain but also in the popular media, and has probably had some increase recently in academic, professional and military quarters. So this phenomenon is deemed as a normal procedure ai...

Descripción completa

Detalles Bibliográficos
Autores principales: Garasic, Mirko D., Lavazza, Andrea
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Frontiers Media S.A. 2015
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4340197/
https://www.ncbi.nlm.nih.gov/pubmed/25762902
http://dx.doi.org/10.3389/fnsys.2015.00013
_version_ 1782358989898514432
author Garasic, Mirko D.
Lavazza, Andrea
author_facet Garasic, Mirko D.
Lavazza, Andrea
author_sort Garasic, Mirko D.
collection PubMed
description The use of pharmaceuticals cognitive enhancers (PCE) has been stirring growing interest, not only in the scientific domain but also in the popular media, and has probably had some increase recently in academic, professional and military quarters. So this phenomenon is deemed as a normal procedure aimed at improving the performance of an individual as well as the overall standards of an organization. Although the vast majority of countries have some kind of restrictions to reduce the wide non-medical usage of PCE, these can be overcome quite easily. In arguing for our explicit claim that, in many contexts, the use of cognitive enhancers should be disclosed—as a moral and socially relevant duty—we maintain that PCE present typical, or at least not rare, properties. The features are the following: (a) the enhancer has acute and/or chronic effects. In the first case, shortly after taking the drug the performance is significantly better than average; in the second case, there is a growing or lasting effect, which, however, is poised to diminish when one stops taking the drug; (b) those effects are significant (there is a difference in the outcome considered between taking and not taking the drug) and sometimes dramatic; and (c) a third feature, not directly related to enhancers as such, is their varying safety, availability, and legal permissibility, which might either induce people to take them or refrain them from doing so. We will consider the issue of fairness due to “unenhanced” people as well as the potentially dysfunctional social consequences of an undisclosed PCE use.
format Online
Article
Text
id pubmed-4340197
institution National Center for Biotechnology Information
language English
publishDate 2015
publisher Frontiers Media S.A.
record_format MEDLINE/PubMed
spelling pubmed-43401972015-03-11 Performance enhancement in the workplace: why and when healthy individuals should disclose their reliance on pharmaceutical cognitive enhancers Garasic, Mirko D. Lavazza, Andrea Front Syst Neurosci Neuroscience The use of pharmaceuticals cognitive enhancers (PCE) has been stirring growing interest, not only in the scientific domain but also in the popular media, and has probably had some increase recently in academic, professional and military quarters. So this phenomenon is deemed as a normal procedure aimed at improving the performance of an individual as well as the overall standards of an organization. Although the vast majority of countries have some kind of restrictions to reduce the wide non-medical usage of PCE, these can be overcome quite easily. In arguing for our explicit claim that, in many contexts, the use of cognitive enhancers should be disclosed—as a moral and socially relevant duty—we maintain that PCE present typical, or at least not rare, properties. The features are the following: (a) the enhancer has acute and/or chronic effects. In the first case, shortly after taking the drug the performance is significantly better than average; in the second case, there is a growing or lasting effect, which, however, is poised to diminish when one stops taking the drug; (b) those effects are significant (there is a difference in the outcome considered between taking and not taking the drug) and sometimes dramatic; and (c) a third feature, not directly related to enhancers as such, is their varying safety, availability, and legal permissibility, which might either induce people to take them or refrain them from doing so. We will consider the issue of fairness due to “unenhanced” people as well as the potentially dysfunctional social consequences of an undisclosed PCE use. Frontiers Media S.A. 2015-02-25 /pmc/articles/PMC4340197/ /pubmed/25762902 http://dx.doi.org/10.3389/fnsys.2015.00013 Text en Copyright © 2015 Garasic and Lavazza. http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution and reproduction in other forums is permitted, provided the original author(s) or licensor are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.
spellingShingle Neuroscience
Garasic, Mirko D.
Lavazza, Andrea
Performance enhancement in the workplace: why and when healthy individuals should disclose their reliance on pharmaceutical cognitive enhancers
title Performance enhancement in the workplace: why and when healthy individuals should disclose their reliance on pharmaceutical cognitive enhancers
title_full Performance enhancement in the workplace: why and when healthy individuals should disclose their reliance on pharmaceutical cognitive enhancers
title_fullStr Performance enhancement in the workplace: why and when healthy individuals should disclose their reliance on pharmaceutical cognitive enhancers
title_full_unstemmed Performance enhancement in the workplace: why and when healthy individuals should disclose their reliance on pharmaceutical cognitive enhancers
title_short Performance enhancement in the workplace: why and when healthy individuals should disclose their reliance on pharmaceutical cognitive enhancers
title_sort performance enhancement in the workplace: why and when healthy individuals should disclose their reliance on pharmaceutical cognitive enhancers
topic Neuroscience
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4340197/
https://www.ncbi.nlm.nih.gov/pubmed/25762902
http://dx.doi.org/10.3389/fnsys.2015.00013
work_keys_str_mv AT garasicmirkod performanceenhancementintheworkplacewhyandwhenhealthyindividualsshoulddisclosetheirrelianceonpharmaceuticalcognitiveenhancers
AT lavazzaandrea performanceenhancementintheworkplacewhyandwhenhealthyindividualsshoulddisclosetheirrelianceonpharmaceuticalcognitiveenhancers