Cargando…

Health and use of health services of people who are homeless and at risk of homelessness who receive free primary health care in Dublin

BACKGROUND: Homeless populations experience poorer physical and mental health, and more barriers to accessing adequate healthcare. This study investigates the health of this population, following the provision of a free to access primary care service for homeless people in Dublin (Safetynet). The he...

Descripción completa

Detalles Bibliográficos
Autores principales: Keogh, Claire, O’Brien, Kirsty K, Hoban, Anthony, O’Carroll, Austin, Fahey, Tom
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2015
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4343065/
https://www.ncbi.nlm.nih.gov/pubmed/25884629
http://dx.doi.org/10.1186/s12913-015-0716-4
_version_ 1782359355685863424
author Keogh, Claire
O’Brien, Kirsty K
Hoban, Anthony
O’Carroll, Austin
Fahey, Tom
author_facet Keogh, Claire
O’Brien, Kirsty K
Hoban, Anthony
O’Carroll, Austin
Fahey, Tom
author_sort Keogh, Claire
collection PubMed
description BACKGROUND: Homeless populations experience poorer physical and mental health, and more barriers to accessing adequate healthcare. This study investigates the health of this population, following the provision of a free to access primary care service for homeless people in Dublin (Safetynet). The health of this group will be compared to previous studies on homelessness conducted in Dublin prior to the establishment of this service (in 1997 and 2005). METHODS: Participants were recruited through Safetynet clinics. A 133-item questionnaire was administered to determine participants’ physical and mental well-being, use of health services and healthcare needs. Prescription data was extracted from participants’ electronic health records. RESULTS: A total of 105 participants were recruited. The majority were < 45 years of age (69%), male (75%), single (52%), Irish (74%) and had children (52%). Multimorbidity was common; with 5.3 ± 2.7 (mean ± SD) physical conditions reported per person. A large proportion of participants had at some point received a formal diagnosis of a mental health condition (70%; 73/105), including depression (50%; 52/105), addiction disorder (39%), anxiety (36%; 38/105), schizophrenia (13%; 14/105) and bipolar disorder (6%; 6/105). With regards to illicit drug use, 60% (63/105) of participants reported ever using drugs, while 33% (35/105) reported being active drug users. Based on AUDIT C criteria, 53% had an alcohol problem. Compared to previous studies, participants reported more positive ratings of health (70% vs. 57% in 1997 and 46% in 2005). The proportion of participants on one or more prescription medication was higher than in previous studies (81% vs. 32% in 1997 and 49% in 2005) and there was a decrease in attendance at outpatients departments (17% vs. 27% in 2005) and a trend towards a decrease in attendance at Accident and Emergency departments (A & E) (29% vs. 37% in 2005). CONCLUSIONS: This vulnerable population has many physical and mental health problems. Use of drugs, alcohol and smoking is common. Following the establishment of Safetynet, self-reported health was rated more positively, there was also a decrease in the use of A & E and outpatient services and an increase in prescription medicines. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s12913-015-0716-4) contains supplementary material, which is available to authorized users.
format Online
Article
Text
id pubmed-4343065
institution National Center for Biotechnology Information
language English
publishDate 2015
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-43430652015-02-28 Health and use of health services of people who are homeless and at risk of homelessness who receive free primary health care in Dublin Keogh, Claire O’Brien, Kirsty K Hoban, Anthony O’Carroll, Austin Fahey, Tom BMC Health Serv Res Research Article BACKGROUND: Homeless populations experience poorer physical and mental health, and more barriers to accessing adequate healthcare. This study investigates the health of this population, following the provision of a free to access primary care service for homeless people in Dublin (Safetynet). The health of this group will be compared to previous studies on homelessness conducted in Dublin prior to the establishment of this service (in 1997 and 2005). METHODS: Participants were recruited through Safetynet clinics. A 133-item questionnaire was administered to determine participants’ physical and mental well-being, use of health services and healthcare needs. Prescription data was extracted from participants’ electronic health records. RESULTS: A total of 105 participants were recruited. The majority were < 45 years of age (69%), male (75%), single (52%), Irish (74%) and had children (52%). Multimorbidity was common; with 5.3 ± 2.7 (mean ± SD) physical conditions reported per person. A large proportion of participants had at some point received a formal diagnosis of a mental health condition (70%; 73/105), including depression (50%; 52/105), addiction disorder (39%), anxiety (36%; 38/105), schizophrenia (13%; 14/105) and bipolar disorder (6%; 6/105). With regards to illicit drug use, 60% (63/105) of participants reported ever using drugs, while 33% (35/105) reported being active drug users. Based on AUDIT C criteria, 53% had an alcohol problem. Compared to previous studies, participants reported more positive ratings of health (70% vs. 57% in 1997 and 46% in 2005). The proportion of participants on one or more prescription medication was higher than in previous studies (81% vs. 32% in 1997 and 49% in 2005) and there was a decrease in attendance at outpatients departments (17% vs. 27% in 2005) and a trend towards a decrease in attendance at Accident and Emergency departments (A & E) (29% vs. 37% in 2005). CONCLUSIONS: This vulnerable population has many physical and mental health problems. Use of drugs, alcohol and smoking is common. Following the establishment of Safetynet, self-reported health was rated more positively, there was also a decrease in the use of A & E and outpatient services and an increase in prescription medicines. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s12913-015-0716-4) contains supplementary material, which is available to authorized users. BioMed Central 2015-02-12 /pmc/articles/PMC4343065/ /pubmed/25884629 http://dx.doi.org/10.1186/s12913-015-0716-4 Text en © Keogh et al.; licensee BioMed Central. 2015 This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly credited. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research Article
Keogh, Claire
O’Brien, Kirsty K
Hoban, Anthony
O’Carroll, Austin
Fahey, Tom
Health and use of health services of people who are homeless and at risk of homelessness who receive free primary health care in Dublin
title Health and use of health services of people who are homeless and at risk of homelessness who receive free primary health care in Dublin
title_full Health and use of health services of people who are homeless and at risk of homelessness who receive free primary health care in Dublin
title_fullStr Health and use of health services of people who are homeless and at risk of homelessness who receive free primary health care in Dublin
title_full_unstemmed Health and use of health services of people who are homeless and at risk of homelessness who receive free primary health care in Dublin
title_short Health and use of health services of people who are homeless and at risk of homelessness who receive free primary health care in Dublin
title_sort health and use of health services of people who are homeless and at risk of homelessness who receive free primary health care in dublin
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4343065/
https://www.ncbi.nlm.nih.gov/pubmed/25884629
http://dx.doi.org/10.1186/s12913-015-0716-4
work_keys_str_mv AT keoghclaire healthanduseofhealthservicesofpeoplewhoarehomelessandatriskofhomelessnesswhoreceivefreeprimaryhealthcareindublin
AT obrienkirstyk healthanduseofhealthservicesofpeoplewhoarehomelessandatriskofhomelessnesswhoreceivefreeprimaryhealthcareindublin
AT hobananthony healthanduseofhealthservicesofpeoplewhoarehomelessandatriskofhomelessnesswhoreceivefreeprimaryhealthcareindublin
AT ocarrollaustin healthanduseofhealthservicesofpeoplewhoarehomelessandatriskofhomelessnesswhoreceivefreeprimaryhealthcareindublin
AT faheytom healthanduseofhealthservicesofpeoplewhoarehomelessandatriskofhomelessnesswhoreceivefreeprimaryhealthcareindublin