Cargando…

Associations between parental BMI, socioeconomic factors, family structure and overweight in Finnish children: a path model approach

BACKGROUND: The aim of this study was to assess the less studied interrelationships and pathways between parental BMI, socioeconomic factors, family structure and childhood overweight. METHODS: The cross-sectional LATE-study was carried out in Finland in 2007–2009. The data for the analyses was clas...

Descripción completa

Detalles Bibliográficos
Autores principales: Parikka, Suvi, Mäki, Päivi, Levälahti, Esko, Lehtinen-Jacks, Susanna, Martelin, Tuija, Laatikainen, Tiina
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2015
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4371876/
https://www.ncbi.nlm.nih.gov/pubmed/25885334
http://dx.doi.org/10.1186/s12889-015-1548-1
_version_ 1782363109612060672
author Parikka, Suvi
Mäki, Päivi
Levälahti, Esko
Lehtinen-Jacks, Susanna
Martelin, Tuija
Laatikainen, Tiina
author_facet Parikka, Suvi
Mäki, Päivi
Levälahti, Esko
Lehtinen-Jacks, Susanna
Martelin, Tuija
Laatikainen, Tiina
author_sort Parikka, Suvi
collection PubMed
description BACKGROUND: The aim of this study was to assess the less studied interrelationships and pathways between parental BMI, socioeconomic factors, family structure and childhood overweight. METHODS: The cross-sectional LATE-study was carried out in Finland in 2007–2009. The data for the analyses was classified into four categories: younger boys and girls (ca 3–8 years) (n = 2573) and older boys and girls (ca 11–16 years) (n = 1836). Associations between parental BMI, education, labor market status, self-perceived income sufficiency, family structure and childhood overweight were first examined by logistic regression analyses. As parental BMI and education had the most consistent associations with childhood overweight, the direct and indirect (mediated by parental BMI) associations of maternal and paternal education with childhood overweight were further assessed using a path model. RESULTS: Parental BMI and education were the strongest determinants of childhood overweight. Children of overweight parents had an increased risk of being overweight. In younger boys, maternal and paternal education had both direct (b-coefficient paternal −0.21, 95% CI −0.34 to −0.09; maternal −0.17, 95% CI −0.28 to −0.07) and indirect (b-coefficient paternal −0.04, 95% CI −0.07 to −0.02; maternal −0.04, 95% CI −0.06 to −0.02) inverse associations with overweight. Among the older boys, paternal education had both direct (b-coefficient −0.12, 95% CI −0.24 to −0.01) and indirect (b-coefficient −0.03, 95% CI −0.06 to −0.01) inverse associations with overweight, but maternal education had only an indirect association (b-coefficient −0.04, 95% CI −0.07 to −0.02). Among older girls, only an indirect association of maternal education with childhood overweight was found (b-coefficient −0.03, 95% CI −0.06 to −0.01). In younger girls, parental education was not associated with childhood overweight. CONCLUSION: The observed pathways between parental BMI and education and childhood overweight emphasize a need for evidence-based health promotion interventions tailored for families identified with parental overweight and low level of education.
format Online
Article
Text
id pubmed-4371876
institution National Center for Biotechnology Information
language English
publishDate 2015
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-43718762015-03-25 Associations between parental BMI, socioeconomic factors, family structure and overweight in Finnish children: a path model approach Parikka, Suvi Mäki, Päivi Levälahti, Esko Lehtinen-Jacks, Susanna Martelin, Tuija Laatikainen, Tiina BMC Public Health Research Article BACKGROUND: The aim of this study was to assess the less studied interrelationships and pathways between parental BMI, socioeconomic factors, family structure and childhood overweight. METHODS: The cross-sectional LATE-study was carried out in Finland in 2007–2009. The data for the analyses was classified into four categories: younger boys and girls (ca 3–8 years) (n = 2573) and older boys and girls (ca 11–16 years) (n = 1836). Associations between parental BMI, education, labor market status, self-perceived income sufficiency, family structure and childhood overweight were first examined by logistic regression analyses. As parental BMI and education had the most consistent associations with childhood overweight, the direct and indirect (mediated by parental BMI) associations of maternal and paternal education with childhood overweight were further assessed using a path model. RESULTS: Parental BMI and education were the strongest determinants of childhood overweight. Children of overweight parents had an increased risk of being overweight. In younger boys, maternal and paternal education had both direct (b-coefficient paternal −0.21, 95% CI −0.34 to −0.09; maternal −0.17, 95% CI −0.28 to −0.07) and indirect (b-coefficient paternal −0.04, 95% CI −0.07 to −0.02; maternal −0.04, 95% CI −0.06 to −0.02) inverse associations with overweight. Among the older boys, paternal education had both direct (b-coefficient −0.12, 95% CI −0.24 to −0.01) and indirect (b-coefficient −0.03, 95% CI −0.06 to −0.01) inverse associations with overweight, but maternal education had only an indirect association (b-coefficient −0.04, 95% CI −0.07 to −0.02). Among older girls, only an indirect association of maternal education with childhood overweight was found (b-coefficient −0.03, 95% CI −0.06 to −0.01). In younger girls, parental education was not associated with childhood overweight. CONCLUSION: The observed pathways between parental BMI and education and childhood overweight emphasize a need for evidence-based health promotion interventions tailored for families identified with parental overweight and low level of education. BioMed Central 2015-03-19 /pmc/articles/PMC4371876/ /pubmed/25885334 http://dx.doi.org/10.1186/s12889-015-1548-1 Text en © Parikka et al.; licensee BioMed Central. 2015 This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly credited. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research Article
Parikka, Suvi
Mäki, Päivi
Levälahti, Esko
Lehtinen-Jacks, Susanna
Martelin, Tuija
Laatikainen, Tiina
Associations between parental BMI, socioeconomic factors, family structure and overweight in Finnish children: a path model approach
title Associations between parental BMI, socioeconomic factors, family structure and overweight in Finnish children: a path model approach
title_full Associations between parental BMI, socioeconomic factors, family structure and overweight in Finnish children: a path model approach
title_fullStr Associations between parental BMI, socioeconomic factors, family structure and overweight in Finnish children: a path model approach
title_full_unstemmed Associations between parental BMI, socioeconomic factors, family structure and overweight in Finnish children: a path model approach
title_short Associations between parental BMI, socioeconomic factors, family structure and overweight in Finnish children: a path model approach
title_sort associations between parental bmi, socioeconomic factors, family structure and overweight in finnish children: a path model approach
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4371876/
https://www.ncbi.nlm.nih.gov/pubmed/25885334
http://dx.doi.org/10.1186/s12889-015-1548-1
work_keys_str_mv AT parikkasuvi associationsbetweenparentalbmisocioeconomicfactorsfamilystructureandoverweightinfinnishchildrenapathmodelapproach
AT makipaivi associationsbetweenparentalbmisocioeconomicfactorsfamilystructureandoverweightinfinnishchildrenapathmodelapproach
AT levalahtiesko associationsbetweenparentalbmisocioeconomicfactorsfamilystructureandoverweightinfinnishchildrenapathmodelapproach
AT lehtinenjackssusanna associationsbetweenparentalbmisocioeconomicfactorsfamilystructureandoverweightinfinnishchildrenapathmodelapproach
AT martelintuija associationsbetweenparentalbmisocioeconomicfactorsfamilystructureandoverweightinfinnishchildrenapathmodelapproach
AT laatikainentiina associationsbetweenparentalbmisocioeconomicfactorsfamilystructureandoverweightinfinnishchildrenapathmodelapproach