Cargando…

Informing the design of a national screening and treatment programme for chronic viral hepatitis in primary care: qualitative study of at-risk immigrant communities and healthcare professionals

BACKGROUND: Effective strategies are needed to provide screening and treatment for hepatitis B and C to immigrant groups in the UK at high risk of chronic infection. This study aimed to build an understanding of the knowledge, beliefs and attitudes towards these conditions and their management in a...

Descripción completa

Detalles Bibliográficos
Autores principales: Sweeney, Lorna, Owiti, John A, Beharry, Andrew, Bhui, Kamaldeep, Gomes, Jessica, Foster, Graham R, Greenhalgh, Trisha
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2015
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4372168/
https://www.ncbi.nlm.nih.gov/pubmed/25890125
http://dx.doi.org/10.1186/s12913-015-0746-y
_version_ 1782363133730357248
author Sweeney, Lorna
Owiti, John A
Beharry, Andrew
Bhui, Kamaldeep
Gomes, Jessica
Foster, Graham R
Greenhalgh, Trisha
author_facet Sweeney, Lorna
Owiti, John A
Beharry, Andrew
Bhui, Kamaldeep
Gomes, Jessica
Foster, Graham R
Greenhalgh, Trisha
author_sort Sweeney, Lorna
collection PubMed
description BACKGROUND: Effective strategies are needed to provide screening and treatment for hepatitis B and C to immigrant groups in the UK at high risk of chronic infection. This study aimed to build an understanding of the knowledge, beliefs and attitudes towards these conditions and their management in a range of high-risk minority ethnic communities and health professionals, in order to inform the design of a screening and treatment programme in primary care. METHODS: Qualitative data collection consisted of three sequential phases- (i) semi-structured interviews with key informants (n = 17), (ii) focus groups with people from Chinese, Pakistani, Roma, Somali, and French- and English-speaking African communities (n = 95), and (iii) semi-structured interviews with general practitioners (n = 6). Datasets from each phase were analysed using the Framework method. RESULTS: Key informants and general practitioners perceived that there was limited knowledge and understanding about hepatitis B and C within high-risk immigrant communities, and that chronic viral hepatitis did not typically feature in community discourses about serious illness. Many focus group participants were confused about the differences between types of viral hepatitis, held misconceptions regarding transmission, and were unaware of the asymptomatic nature of chronic infection. Most welcomed the idea of a screening programme, but key informants and focus group participants also identified numerous practical barriers to engagement with primary care-based screening and treatment; including language and communication difficulties, limited time (due to long working hours), and (for some) low levels of trust and confidence in general practice-based care. General practitioners expressed concerns about the workload implications and sustainability of screening and treating immigrant patients for chronic viral hepatitis in primary care. CONCLUSIONS: Strategies to reduce the burden of chronic viral hepatitis in immigrant communities will need to consider how levels of understanding about hepatitis B and C within these communities, and barriers to accessing healthcare, may affect capacity to engage with screening and treatment. Services may need to work with community groups and language support services to provide information and wider encouragement for screening. Primary care services will need ongoing consultation regarding their support needs to deliver hepatitis screening and treatment programmes.
format Online
Article
Text
id pubmed-4372168
institution National Center for Biotechnology Information
language English
publishDate 2015
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-43721682015-03-25 Informing the design of a national screening and treatment programme for chronic viral hepatitis in primary care: qualitative study of at-risk immigrant communities and healthcare professionals Sweeney, Lorna Owiti, John A Beharry, Andrew Bhui, Kamaldeep Gomes, Jessica Foster, Graham R Greenhalgh, Trisha BMC Health Serv Res Research Article BACKGROUND: Effective strategies are needed to provide screening and treatment for hepatitis B and C to immigrant groups in the UK at high risk of chronic infection. This study aimed to build an understanding of the knowledge, beliefs and attitudes towards these conditions and their management in a range of high-risk minority ethnic communities and health professionals, in order to inform the design of a screening and treatment programme in primary care. METHODS: Qualitative data collection consisted of three sequential phases- (i) semi-structured interviews with key informants (n = 17), (ii) focus groups with people from Chinese, Pakistani, Roma, Somali, and French- and English-speaking African communities (n = 95), and (iii) semi-structured interviews with general practitioners (n = 6). Datasets from each phase were analysed using the Framework method. RESULTS: Key informants and general practitioners perceived that there was limited knowledge and understanding about hepatitis B and C within high-risk immigrant communities, and that chronic viral hepatitis did not typically feature in community discourses about serious illness. Many focus group participants were confused about the differences between types of viral hepatitis, held misconceptions regarding transmission, and were unaware of the asymptomatic nature of chronic infection. Most welcomed the idea of a screening programme, but key informants and focus group participants also identified numerous practical barriers to engagement with primary care-based screening and treatment; including language and communication difficulties, limited time (due to long working hours), and (for some) low levels of trust and confidence in general practice-based care. General practitioners expressed concerns about the workload implications and sustainability of screening and treating immigrant patients for chronic viral hepatitis in primary care. CONCLUSIONS: Strategies to reduce the burden of chronic viral hepatitis in immigrant communities will need to consider how levels of understanding about hepatitis B and C within these communities, and barriers to accessing healthcare, may affect capacity to engage with screening and treatment. Services may need to work with community groups and language support services to provide information and wider encouragement for screening. Primary care services will need ongoing consultation regarding their support needs to deliver hepatitis screening and treatment programmes. BioMed Central 2015-03-13 /pmc/articles/PMC4372168/ /pubmed/25890125 http://dx.doi.org/10.1186/s12913-015-0746-y Text en © Sweeney et al.; licensee BioMed Central. 2015 This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly credited. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research Article
Sweeney, Lorna
Owiti, John A
Beharry, Andrew
Bhui, Kamaldeep
Gomes, Jessica
Foster, Graham R
Greenhalgh, Trisha
Informing the design of a national screening and treatment programme for chronic viral hepatitis in primary care: qualitative study of at-risk immigrant communities and healthcare professionals
title Informing the design of a national screening and treatment programme for chronic viral hepatitis in primary care: qualitative study of at-risk immigrant communities and healthcare professionals
title_full Informing the design of a national screening and treatment programme for chronic viral hepatitis in primary care: qualitative study of at-risk immigrant communities and healthcare professionals
title_fullStr Informing the design of a national screening and treatment programme for chronic viral hepatitis in primary care: qualitative study of at-risk immigrant communities and healthcare professionals
title_full_unstemmed Informing the design of a national screening and treatment programme for chronic viral hepatitis in primary care: qualitative study of at-risk immigrant communities and healthcare professionals
title_short Informing the design of a national screening and treatment programme for chronic viral hepatitis in primary care: qualitative study of at-risk immigrant communities and healthcare professionals
title_sort informing the design of a national screening and treatment programme for chronic viral hepatitis in primary care: qualitative study of at-risk immigrant communities and healthcare professionals
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4372168/
https://www.ncbi.nlm.nih.gov/pubmed/25890125
http://dx.doi.org/10.1186/s12913-015-0746-y
work_keys_str_mv AT sweeneylorna informingthedesignofanationalscreeningandtreatmentprogrammeforchronicviralhepatitisinprimarycarequalitativestudyofatriskimmigrantcommunitiesandhealthcareprofessionals
AT owitijohna informingthedesignofanationalscreeningandtreatmentprogrammeforchronicviralhepatitisinprimarycarequalitativestudyofatriskimmigrantcommunitiesandhealthcareprofessionals
AT beharryandrew informingthedesignofanationalscreeningandtreatmentprogrammeforchronicviralhepatitisinprimarycarequalitativestudyofatriskimmigrantcommunitiesandhealthcareprofessionals
AT bhuikamaldeep informingthedesignofanationalscreeningandtreatmentprogrammeforchronicviralhepatitisinprimarycarequalitativestudyofatriskimmigrantcommunitiesandhealthcareprofessionals
AT gomesjessica informingthedesignofanationalscreeningandtreatmentprogrammeforchronicviralhepatitisinprimarycarequalitativestudyofatriskimmigrantcommunitiesandhealthcareprofessionals
AT fostergrahamr informingthedesignofanationalscreeningandtreatmentprogrammeforchronicviralhepatitisinprimarycarequalitativestudyofatriskimmigrantcommunitiesandhealthcareprofessionals
AT greenhalghtrisha informingthedesignofanationalscreeningandtreatmentprogrammeforchronicviralhepatitisinprimarycarequalitativestudyofatriskimmigrantcommunitiesandhealthcareprofessionals