Cargando…
Corrigendum: the FMRFamide-like peptide family in nematodes
| Autores principales: | , , , , |
|---|---|
| Formato: | Online Artículo Texto |
| Lenguaje: | English |
| Publicado: |
Frontiers Media S.A.
2015
|
| Materias: | |
| Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4391037/ https://www.ncbi.nlm.nih.gov/pubmed/25914615 http://dx.doi.org/10.3389/fnins.2015.00120 |
| _version_ | 1782365754787627008 |
|---|---|
| author | Peymen, Katleen Watteyne, Jan Frooninckx, Lotte Schoofs, Liliane Beets, Isabel |
| author_facet | Peymen, Katleen Watteyne, Jan Frooninckx, Lotte Schoofs, Liliane Beets, Isabel |
| author_sort | Peymen, Katleen |
| collection | PubMed |
| description | |
| format | Online Article Text |
| id | pubmed-4391037 |
| institution | National Center for Biotechnology Information |
| language | English |
| publishDate | 2015 |
| publisher | Frontiers Media S.A. |
| record_format | MEDLINE/PubMed |
| spelling | pubmed-43910372015-04-24 Corrigendum: the FMRFamide-like peptide family in nematodes Peymen, Katleen Watteyne, Jan Frooninckx, Lotte Schoofs, Liliane Beets, Isabel Front Neurosci Endocrinology Frontiers Media S.A. 2015-04-09 /pmc/articles/PMC4391037/ /pubmed/25914615 http://dx.doi.org/10.3389/fnins.2015.00120 Text en Copyright © 2015 Peymen, Watteyne, Frooninckx, Schoofs and Beets. http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) or licensor are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms. |
| spellingShingle | Endocrinology Peymen, Katleen Watteyne, Jan Frooninckx, Lotte Schoofs, Liliane Beets, Isabel Corrigendum: the FMRFamide-like peptide family in nematodes |
| title | Corrigendum: the FMRFamide-like peptide family in nematodes |
| title_full | Corrigendum: the FMRFamide-like peptide family in nematodes |
| title_fullStr | Corrigendum: the FMRFamide-like peptide family in nematodes |
| title_full_unstemmed | Corrigendum: the FMRFamide-like peptide family in nematodes |
| title_short | Corrigendum: the FMRFamide-like peptide family in nematodes |
| title_sort | corrigendum: the fmrfamide-like peptide family in nematodes |
| topic | Endocrinology |
| url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4391037/ https://www.ncbi.nlm.nih.gov/pubmed/25914615 http://dx.doi.org/10.3389/fnins.2015.00120 |
| work_keys_str_mv | AT peymenkatleen corrigendumthefmrfamidelikepeptidefamilyinnematodes AT watteynejan corrigendumthefmrfamidelikepeptidefamilyinnematodes AT frooninckxlotte corrigendumthefmrfamidelikepeptidefamilyinnematodes AT schoofsliliane corrigendumthefmrfamidelikepeptidefamilyinnematodes AT beetsisabel corrigendumthefmrfamidelikepeptidefamilyinnematodes |