Cargando…
Magnetic Cell Labeling of Primary and Stem Cell-Derived Pig Hepatocytes for MRI-Based Cell Tracking of Hepatocyte Transplantation
Pig hepatocytes are an important investigational tool for optimizing hepatocyte transplantation schemes in both allogeneic and xenogeneic transplant scenarios. MRI can be used to serially monitor the transplanted cells, but only if the hepatocytes can be labeled with a magnetic particle. In this wor...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Public Library of Science
2015
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4391930/ https://www.ncbi.nlm.nih.gov/pubmed/25856627 http://dx.doi.org/10.1371/journal.pone.0123282 |
_version_ | 1782365899449171968 |
---|---|
author | Roach, Dwayne R. Garrett, Wesley M. Welch, Glenn Caperna, Thomas J. Talbot, Neil C. Shapiro, Erik M. |
author_facet | Roach, Dwayne R. Garrett, Wesley M. Welch, Glenn Caperna, Thomas J. Talbot, Neil C. Shapiro, Erik M. |
author_sort | Roach, Dwayne R. |
collection | PubMed |
description | Pig hepatocytes are an important investigational tool for optimizing hepatocyte transplantation schemes in both allogeneic and xenogeneic transplant scenarios. MRI can be used to serially monitor the transplanted cells, but only if the hepatocytes can be labeled with a magnetic particle. In this work, we describe culture conditions for magnetic cell labeling of cells from two different pig hepatocyte cell sources; primary pig hepatocytes (ppHEP) and stem cell-derived hepatocytes (PICM-19FF). The magnetic particle is a micron-sized iron oxide particle (MPIO) that has been extensively studied for magnetic cell labeling for MRI-based cell tracking. ppHEP could endocytose MPIO with labeling percentages as high as 70%, achieving iron content as high as ~55 pg/cell, with >75% viability. PICM-19FF had labeling >97%, achieving iron content ~38 pg/cell, with viability >99%. Extensive morphological and functional assays indicated that magnetic cell labeling was benign to the cells. The results encourage the use of MRI-based cell tracking for the development and clinical use of hepatocyte transplantation methodologies. Further, these results generally highlight the importance of functional cell assays in the evaluation of contrast agent biocompatibility. |
format | Online Article Text |
id | pubmed-4391930 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2015 |
publisher | Public Library of Science |
record_format | MEDLINE/PubMed |
spelling | pubmed-43919302015-04-21 Magnetic Cell Labeling of Primary and Stem Cell-Derived Pig Hepatocytes for MRI-Based Cell Tracking of Hepatocyte Transplantation Roach, Dwayne R. Garrett, Wesley M. Welch, Glenn Caperna, Thomas J. Talbot, Neil C. Shapiro, Erik M. PLoS One Research Article Pig hepatocytes are an important investigational tool for optimizing hepatocyte transplantation schemes in both allogeneic and xenogeneic transplant scenarios. MRI can be used to serially monitor the transplanted cells, but only if the hepatocytes can be labeled with a magnetic particle. In this work, we describe culture conditions for magnetic cell labeling of cells from two different pig hepatocyte cell sources; primary pig hepatocytes (ppHEP) and stem cell-derived hepatocytes (PICM-19FF). The magnetic particle is a micron-sized iron oxide particle (MPIO) that has been extensively studied for magnetic cell labeling for MRI-based cell tracking. ppHEP could endocytose MPIO with labeling percentages as high as 70%, achieving iron content as high as ~55 pg/cell, with >75% viability. PICM-19FF had labeling >97%, achieving iron content ~38 pg/cell, with viability >99%. Extensive morphological and functional assays indicated that magnetic cell labeling was benign to the cells. The results encourage the use of MRI-based cell tracking for the development and clinical use of hepatocyte transplantation methodologies. Further, these results generally highlight the importance of functional cell assays in the evaluation of contrast agent biocompatibility. Public Library of Science 2015-04-09 /pmc/articles/PMC4391930/ /pubmed/25856627 http://dx.doi.org/10.1371/journal.pone.0123282 Text en https://creativecommons.org/publicdomain/zero/1.0/ This is an open-access article distributed under the terms of the Creative Commons Public Domain declaration, which stipulates that, once placed in the public domain, this work may be freely reproduced, distributed, transmitted, modified, built upon, or otherwise used by anyone for any lawful purpose. |
spellingShingle | Research Article Roach, Dwayne R. Garrett, Wesley M. Welch, Glenn Caperna, Thomas J. Talbot, Neil C. Shapiro, Erik M. Magnetic Cell Labeling of Primary and Stem Cell-Derived Pig Hepatocytes for MRI-Based Cell Tracking of Hepatocyte Transplantation |
title | Magnetic Cell Labeling of Primary and Stem Cell-Derived Pig Hepatocytes for MRI-Based Cell Tracking of Hepatocyte Transplantation |
title_full | Magnetic Cell Labeling of Primary and Stem Cell-Derived Pig Hepatocytes for MRI-Based Cell Tracking of Hepatocyte Transplantation |
title_fullStr | Magnetic Cell Labeling of Primary and Stem Cell-Derived Pig Hepatocytes for MRI-Based Cell Tracking of Hepatocyte Transplantation |
title_full_unstemmed | Magnetic Cell Labeling of Primary and Stem Cell-Derived Pig Hepatocytes for MRI-Based Cell Tracking of Hepatocyte Transplantation |
title_short | Magnetic Cell Labeling of Primary and Stem Cell-Derived Pig Hepatocytes for MRI-Based Cell Tracking of Hepatocyte Transplantation |
title_sort | magnetic cell labeling of primary and stem cell-derived pig hepatocytes for mri-based cell tracking of hepatocyte transplantation |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4391930/ https://www.ncbi.nlm.nih.gov/pubmed/25856627 http://dx.doi.org/10.1371/journal.pone.0123282 |
work_keys_str_mv | AT roachdwayner magneticcelllabelingofprimaryandstemcellderivedpighepatocytesformribasedcelltrackingofhepatocytetransplantation AT garrettwesleym magneticcelllabelingofprimaryandstemcellderivedpighepatocytesformribasedcelltrackingofhepatocytetransplantation AT welchglenn magneticcelllabelingofprimaryandstemcellderivedpighepatocytesformribasedcelltrackingofhepatocytetransplantation AT capernathomasj magneticcelllabelingofprimaryandstemcellderivedpighepatocytesformribasedcelltrackingofhepatocytetransplantation AT talbotneilc magneticcelllabelingofprimaryandstemcellderivedpighepatocytesformribasedcelltrackingofhepatocytetransplantation AT shapiroerikm magneticcelllabelingofprimaryandstemcellderivedpighepatocytesformribasedcelltrackingofhepatocytetransplantation |