Cargando…

Magnetic Cell Labeling of Primary and Stem Cell-Derived Pig Hepatocytes for MRI-Based Cell Tracking of Hepatocyte Transplantation

Pig hepatocytes are an important investigational tool for optimizing hepatocyte transplantation schemes in both allogeneic and xenogeneic transplant scenarios. MRI can be used to serially monitor the transplanted cells, but only if the hepatocytes can be labeled with a magnetic particle. In this wor...

Descripción completa

Detalles Bibliográficos
Autores principales: Roach, Dwayne R., Garrett, Wesley M., Welch, Glenn, Caperna, Thomas J., Talbot, Neil C., Shapiro, Erik M.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Public Library of Science 2015
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4391930/
https://www.ncbi.nlm.nih.gov/pubmed/25856627
http://dx.doi.org/10.1371/journal.pone.0123282
_version_ 1782365899449171968
author Roach, Dwayne R.
Garrett, Wesley M.
Welch, Glenn
Caperna, Thomas J.
Talbot, Neil C.
Shapiro, Erik M.
author_facet Roach, Dwayne R.
Garrett, Wesley M.
Welch, Glenn
Caperna, Thomas J.
Talbot, Neil C.
Shapiro, Erik M.
author_sort Roach, Dwayne R.
collection PubMed
description Pig hepatocytes are an important investigational tool for optimizing hepatocyte transplantation schemes in both allogeneic and xenogeneic transplant scenarios. MRI can be used to serially monitor the transplanted cells, but only if the hepatocytes can be labeled with a magnetic particle. In this work, we describe culture conditions for magnetic cell labeling of cells from two different pig hepatocyte cell sources; primary pig hepatocytes (ppHEP) and stem cell-derived hepatocytes (PICM-19FF). The magnetic particle is a micron-sized iron oxide particle (MPIO) that has been extensively studied for magnetic cell labeling for MRI-based cell tracking. ppHEP could endocytose MPIO with labeling percentages as high as 70%, achieving iron content as high as ~55 pg/cell, with >75% viability. PICM-19FF had labeling >97%, achieving iron content ~38 pg/cell, with viability >99%. Extensive morphological and functional assays indicated that magnetic cell labeling was benign to the cells. The results encourage the use of MRI-based cell tracking for the development and clinical use of hepatocyte transplantation methodologies. Further, these results generally highlight the importance of functional cell assays in the evaluation of contrast agent biocompatibility.
format Online
Article
Text
id pubmed-4391930
institution National Center for Biotechnology Information
language English
publishDate 2015
publisher Public Library of Science
record_format MEDLINE/PubMed
spelling pubmed-43919302015-04-21 Magnetic Cell Labeling of Primary and Stem Cell-Derived Pig Hepatocytes for MRI-Based Cell Tracking of Hepatocyte Transplantation Roach, Dwayne R. Garrett, Wesley M. Welch, Glenn Caperna, Thomas J. Talbot, Neil C. Shapiro, Erik M. PLoS One Research Article Pig hepatocytes are an important investigational tool for optimizing hepatocyte transplantation schemes in both allogeneic and xenogeneic transplant scenarios. MRI can be used to serially monitor the transplanted cells, but only if the hepatocytes can be labeled with a magnetic particle. In this work, we describe culture conditions for magnetic cell labeling of cells from two different pig hepatocyte cell sources; primary pig hepatocytes (ppHEP) and stem cell-derived hepatocytes (PICM-19FF). The magnetic particle is a micron-sized iron oxide particle (MPIO) that has been extensively studied for magnetic cell labeling for MRI-based cell tracking. ppHEP could endocytose MPIO with labeling percentages as high as 70%, achieving iron content as high as ~55 pg/cell, with >75% viability. PICM-19FF had labeling >97%, achieving iron content ~38 pg/cell, with viability >99%. Extensive morphological and functional assays indicated that magnetic cell labeling was benign to the cells. The results encourage the use of MRI-based cell tracking for the development and clinical use of hepatocyte transplantation methodologies. Further, these results generally highlight the importance of functional cell assays in the evaluation of contrast agent biocompatibility. Public Library of Science 2015-04-09 /pmc/articles/PMC4391930/ /pubmed/25856627 http://dx.doi.org/10.1371/journal.pone.0123282 Text en https://creativecommons.org/publicdomain/zero/1.0/ This is an open-access article distributed under the terms of the Creative Commons Public Domain declaration, which stipulates that, once placed in the public domain, this work may be freely reproduced, distributed, transmitted, modified, built upon, or otherwise used by anyone for any lawful purpose.
spellingShingle Research Article
Roach, Dwayne R.
Garrett, Wesley M.
Welch, Glenn
Caperna, Thomas J.
Talbot, Neil C.
Shapiro, Erik M.
Magnetic Cell Labeling of Primary and Stem Cell-Derived Pig Hepatocytes for MRI-Based Cell Tracking of Hepatocyte Transplantation
title Magnetic Cell Labeling of Primary and Stem Cell-Derived Pig Hepatocytes for MRI-Based Cell Tracking of Hepatocyte Transplantation
title_full Magnetic Cell Labeling of Primary and Stem Cell-Derived Pig Hepatocytes for MRI-Based Cell Tracking of Hepatocyte Transplantation
title_fullStr Magnetic Cell Labeling of Primary and Stem Cell-Derived Pig Hepatocytes for MRI-Based Cell Tracking of Hepatocyte Transplantation
title_full_unstemmed Magnetic Cell Labeling of Primary and Stem Cell-Derived Pig Hepatocytes for MRI-Based Cell Tracking of Hepatocyte Transplantation
title_short Magnetic Cell Labeling of Primary and Stem Cell-Derived Pig Hepatocytes for MRI-Based Cell Tracking of Hepatocyte Transplantation
title_sort magnetic cell labeling of primary and stem cell-derived pig hepatocytes for mri-based cell tracking of hepatocyte transplantation
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4391930/
https://www.ncbi.nlm.nih.gov/pubmed/25856627
http://dx.doi.org/10.1371/journal.pone.0123282
work_keys_str_mv AT roachdwayner magneticcelllabelingofprimaryandstemcellderivedpighepatocytesformribasedcelltrackingofhepatocytetransplantation
AT garrettwesleym magneticcelllabelingofprimaryandstemcellderivedpighepatocytesformribasedcelltrackingofhepatocytetransplantation
AT welchglenn magneticcelllabelingofprimaryandstemcellderivedpighepatocytesformribasedcelltrackingofhepatocytetransplantation
AT capernathomasj magneticcelllabelingofprimaryandstemcellderivedpighepatocytesformribasedcelltrackingofhepatocytetransplantation
AT talbotneilc magneticcelllabelingofprimaryandstemcellderivedpighepatocytesformribasedcelltrackingofhepatocytetransplantation
AT shapiroerikm magneticcelllabelingofprimaryandstemcellderivedpighepatocytesformribasedcelltrackingofhepatocytetransplantation