Cargando…

Transgenic Fatal Familial Insomnia Mice Indicate Prion Infectivity-Independent Mechanisms of Pathogenesis and Phenotypic Expression of Disease

Fatal familial insomnia (FFI) and a genetic form of Creutzfeldt-Jakob disease (CJD(178)) are clinically different prion disorders linked to the D178N prion protein (PrP) mutation. The disease phenotype is determined by the 129 M/V polymorphism on the mutant allele, which is thought to influence D178...

Descripción completa

Detalles Bibliográficos
Autores principales: Bouybayoune, Ihssane, Mantovani, Susanna, Del Gallo, Federico, Bertani, Ilaria, Restelli, Elena, Comerio, Liliana, Tapella, Laura, Baracchi, Francesca, Fernández-Borges, Natalia, Mangieri, Michela, Bisighini, Cinzia, Beznoussenko, Galina V., Paladini, Alessandra, Balducci, Claudia, Micotti, Edoardo, Forloni, Gianluigi, Castilla, Joaquín, Fiordaliso, Fabio, Tagliavini, Fabrizio, Imeri, Luca, Chiesa, Roberto
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Public Library of Science 2015
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4400166/
https://www.ncbi.nlm.nih.gov/pubmed/25880443
http://dx.doi.org/10.1371/journal.ppat.1004796
_version_ 1782367001212092416
author Bouybayoune, Ihssane
Mantovani, Susanna
Del Gallo, Federico
Bertani, Ilaria
Restelli, Elena
Comerio, Liliana
Tapella, Laura
Baracchi, Francesca
Fernández-Borges, Natalia
Mangieri, Michela
Bisighini, Cinzia
Beznoussenko, Galina V.
Paladini, Alessandra
Balducci, Claudia
Micotti, Edoardo
Forloni, Gianluigi
Castilla, Joaquín
Fiordaliso, Fabio
Tagliavini, Fabrizio
Imeri, Luca
Chiesa, Roberto
author_facet Bouybayoune, Ihssane
Mantovani, Susanna
Del Gallo, Federico
Bertani, Ilaria
Restelli, Elena
Comerio, Liliana
Tapella, Laura
Baracchi, Francesca
Fernández-Borges, Natalia
Mangieri, Michela
Bisighini, Cinzia
Beznoussenko, Galina V.
Paladini, Alessandra
Balducci, Claudia
Micotti, Edoardo
Forloni, Gianluigi
Castilla, Joaquín
Fiordaliso, Fabio
Tagliavini, Fabrizio
Imeri, Luca
Chiesa, Roberto
author_sort Bouybayoune, Ihssane
collection PubMed
description Fatal familial insomnia (FFI) and a genetic form of Creutzfeldt-Jakob disease (CJD(178)) are clinically different prion disorders linked to the D178N prion protein (PrP) mutation. The disease phenotype is determined by the 129 M/V polymorphism on the mutant allele, which is thought to influence D178N PrP misfolding, leading to the formation of distinctive prion strains with specific neurotoxic properties. However, the mechanism by which misfolded variants of mutant PrP cause different diseases is not known. We generated transgenic (Tg) mice expressing the mouse PrP homolog of the FFI mutation. These mice synthesize a misfolded form of mutant PrP in their brains and develop a neurological illness with severe sleep disruption, highly reminiscent of FFI and different from that of analogously generated Tg(CJD) mice modeling CJD(178). No prion infectivity was detectable in Tg(FFI) and Tg(CJD) brains by bioassay or protein misfolding cyclic amplification, indicating that mutant PrP has disease-encoding properties that do not depend on its ability to propagate its misfolded conformation. Tg(FFI) and Tg(CJD) neurons have different patterns of intracellular PrP accumulation associated with distinct morphological abnormalities of the endoplasmic reticulum and Golgi, suggesting that mutation-specific alterations of secretory transport may contribute to the disease phenotype.
format Online
Article
Text
id pubmed-4400166
institution National Center for Biotechnology Information
language English
publishDate 2015
publisher Public Library of Science
record_format MEDLINE/PubMed
spelling pubmed-44001662015-04-21 Transgenic Fatal Familial Insomnia Mice Indicate Prion Infectivity-Independent Mechanisms of Pathogenesis and Phenotypic Expression of Disease Bouybayoune, Ihssane Mantovani, Susanna Del Gallo, Federico Bertani, Ilaria Restelli, Elena Comerio, Liliana Tapella, Laura Baracchi, Francesca Fernández-Borges, Natalia Mangieri, Michela Bisighini, Cinzia Beznoussenko, Galina V. Paladini, Alessandra Balducci, Claudia Micotti, Edoardo Forloni, Gianluigi Castilla, Joaquín Fiordaliso, Fabio Tagliavini, Fabrizio Imeri, Luca Chiesa, Roberto PLoS Pathog Research Article Fatal familial insomnia (FFI) and a genetic form of Creutzfeldt-Jakob disease (CJD(178)) are clinically different prion disorders linked to the D178N prion protein (PrP) mutation. The disease phenotype is determined by the 129 M/V polymorphism on the mutant allele, which is thought to influence D178N PrP misfolding, leading to the formation of distinctive prion strains with specific neurotoxic properties. However, the mechanism by which misfolded variants of mutant PrP cause different diseases is not known. We generated transgenic (Tg) mice expressing the mouse PrP homolog of the FFI mutation. These mice synthesize a misfolded form of mutant PrP in their brains and develop a neurological illness with severe sleep disruption, highly reminiscent of FFI and different from that of analogously generated Tg(CJD) mice modeling CJD(178). No prion infectivity was detectable in Tg(FFI) and Tg(CJD) brains by bioassay or protein misfolding cyclic amplification, indicating that mutant PrP has disease-encoding properties that do not depend on its ability to propagate its misfolded conformation. Tg(FFI) and Tg(CJD) neurons have different patterns of intracellular PrP accumulation associated with distinct morphological abnormalities of the endoplasmic reticulum and Golgi, suggesting that mutation-specific alterations of secretory transport may contribute to the disease phenotype. Public Library of Science 2015-04-16 /pmc/articles/PMC4400166/ /pubmed/25880443 http://dx.doi.org/10.1371/journal.ppat.1004796 Text en © 2015 Bouybayoune et al http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are properly credited.
spellingShingle Research Article
Bouybayoune, Ihssane
Mantovani, Susanna
Del Gallo, Federico
Bertani, Ilaria
Restelli, Elena
Comerio, Liliana
Tapella, Laura
Baracchi, Francesca
Fernández-Borges, Natalia
Mangieri, Michela
Bisighini, Cinzia
Beznoussenko, Galina V.
Paladini, Alessandra
Balducci, Claudia
Micotti, Edoardo
Forloni, Gianluigi
Castilla, Joaquín
Fiordaliso, Fabio
Tagliavini, Fabrizio
Imeri, Luca
Chiesa, Roberto
Transgenic Fatal Familial Insomnia Mice Indicate Prion Infectivity-Independent Mechanisms of Pathogenesis and Phenotypic Expression of Disease
title Transgenic Fatal Familial Insomnia Mice Indicate Prion Infectivity-Independent Mechanisms of Pathogenesis and Phenotypic Expression of Disease
title_full Transgenic Fatal Familial Insomnia Mice Indicate Prion Infectivity-Independent Mechanisms of Pathogenesis and Phenotypic Expression of Disease
title_fullStr Transgenic Fatal Familial Insomnia Mice Indicate Prion Infectivity-Independent Mechanisms of Pathogenesis and Phenotypic Expression of Disease
title_full_unstemmed Transgenic Fatal Familial Insomnia Mice Indicate Prion Infectivity-Independent Mechanisms of Pathogenesis and Phenotypic Expression of Disease
title_short Transgenic Fatal Familial Insomnia Mice Indicate Prion Infectivity-Independent Mechanisms of Pathogenesis and Phenotypic Expression of Disease
title_sort transgenic fatal familial insomnia mice indicate prion infectivity-independent mechanisms of pathogenesis and phenotypic expression of disease
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4400166/
https://www.ncbi.nlm.nih.gov/pubmed/25880443
http://dx.doi.org/10.1371/journal.ppat.1004796
work_keys_str_mv AT bouybayouneihssane transgenicfatalfamilialinsomniamiceindicateprioninfectivityindependentmechanismsofpathogenesisandphenotypicexpressionofdisease
AT mantovanisusanna transgenicfatalfamilialinsomniamiceindicateprioninfectivityindependentmechanismsofpathogenesisandphenotypicexpressionofdisease
AT delgallofederico transgenicfatalfamilialinsomniamiceindicateprioninfectivityindependentmechanismsofpathogenesisandphenotypicexpressionofdisease
AT bertaniilaria transgenicfatalfamilialinsomniamiceindicateprioninfectivityindependentmechanismsofpathogenesisandphenotypicexpressionofdisease
AT restellielena transgenicfatalfamilialinsomniamiceindicateprioninfectivityindependentmechanismsofpathogenesisandphenotypicexpressionofdisease
AT comerioliliana transgenicfatalfamilialinsomniamiceindicateprioninfectivityindependentmechanismsofpathogenesisandphenotypicexpressionofdisease
AT tapellalaura transgenicfatalfamilialinsomniamiceindicateprioninfectivityindependentmechanismsofpathogenesisandphenotypicexpressionofdisease
AT baracchifrancesca transgenicfatalfamilialinsomniamiceindicateprioninfectivityindependentmechanismsofpathogenesisandphenotypicexpressionofdisease
AT fernandezborgesnatalia transgenicfatalfamilialinsomniamiceindicateprioninfectivityindependentmechanismsofpathogenesisandphenotypicexpressionofdisease
AT mangierimichela transgenicfatalfamilialinsomniamiceindicateprioninfectivityindependentmechanismsofpathogenesisandphenotypicexpressionofdisease
AT bisighinicinzia transgenicfatalfamilialinsomniamiceindicateprioninfectivityindependentmechanismsofpathogenesisandphenotypicexpressionofdisease
AT beznoussenkogalinav transgenicfatalfamilialinsomniamiceindicateprioninfectivityindependentmechanismsofpathogenesisandphenotypicexpressionofdisease
AT paladinialessandra transgenicfatalfamilialinsomniamiceindicateprioninfectivityindependentmechanismsofpathogenesisandphenotypicexpressionofdisease
AT balducciclaudia transgenicfatalfamilialinsomniamiceindicateprioninfectivityindependentmechanismsofpathogenesisandphenotypicexpressionofdisease
AT micottiedoardo transgenicfatalfamilialinsomniamiceindicateprioninfectivityindependentmechanismsofpathogenesisandphenotypicexpressionofdisease
AT forlonigianluigi transgenicfatalfamilialinsomniamiceindicateprioninfectivityindependentmechanismsofpathogenesisandphenotypicexpressionofdisease
AT castillajoaquin transgenicfatalfamilialinsomniamiceindicateprioninfectivityindependentmechanismsofpathogenesisandphenotypicexpressionofdisease
AT fiordalisofabio transgenicfatalfamilialinsomniamiceindicateprioninfectivityindependentmechanismsofpathogenesisandphenotypicexpressionofdisease
AT tagliavinifabrizio transgenicfatalfamilialinsomniamiceindicateprioninfectivityindependentmechanismsofpathogenesisandphenotypicexpressionofdisease
AT imeriluca transgenicfatalfamilialinsomniamiceindicateprioninfectivityindependentmechanismsofpathogenesisandphenotypicexpressionofdisease
AT chiesaroberto transgenicfatalfamilialinsomniamiceindicateprioninfectivityindependentmechanismsofpathogenesisandphenotypicexpressionofdisease