Cargando…
Transgenic Fatal Familial Insomnia Mice Indicate Prion Infectivity-Independent Mechanisms of Pathogenesis and Phenotypic Expression of Disease
Fatal familial insomnia (FFI) and a genetic form of Creutzfeldt-Jakob disease (CJD(178)) are clinically different prion disorders linked to the D178N prion protein (PrP) mutation. The disease phenotype is determined by the 129 M/V polymorphism on the mutant allele, which is thought to influence D178...
Autores principales: | , , , , , , , , , , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Public Library of Science
2015
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4400166/ https://www.ncbi.nlm.nih.gov/pubmed/25880443 http://dx.doi.org/10.1371/journal.ppat.1004796 |
_version_ | 1782367001212092416 |
---|---|
author | Bouybayoune, Ihssane Mantovani, Susanna Del Gallo, Federico Bertani, Ilaria Restelli, Elena Comerio, Liliana Tapella, Laura Baracchi, Francesca Fernández-Borges, Natalia Mangieri, Michela Bisighini, Cinzia Beznoussenko, Galina V. Paladini, Alessandra Balducci, Claudia Micotti, Edoardo Forloni, Gianluigi Castilla, Joaquín Fiordaliso, Fabio Tagliavini, Fabrizio Imeri, Luca Chiesa, Roberto |
author_facet | Bouybayoune, Ihssane Mantovani, Susanna Del Gallo, Federico Bertani, Ilaria Restelli, Elena Comerio, Liliana Tapella, Laura Baracchi, Francesca Fernández-Borges, Natalia Mangieri, Michela Bisighini, Cinzia Beznoussenko, Galina V. Paladini, Alessandra Balducci, Claudia Micotti, Edoardo Forloni, Gianluigi Castilla, Joaquín Fiordaliso, Fabio Tagliavini, Fabrizio Imeri, Luca Chiesa, Roberto |
author_sort | Bouybayoune, Ihssane |
collection | PubMed |
description | Fatal familial insomnia (FFI) and a genetic form of Creutzfeldt-Jakob disease (CJD(178)) are clinically different prion disorders linked to the D178N prion protein (PrP) mutation. The disease phenotype is determined by the 129 M/V polymorphism on the mutant allele, which is thought to influence D178N PrP misfolding, leading to the formation of distinctive prion strains with specific neurotoxic properties. However, the mechanism by which misfolded variants of mutant PrP cause different diseases is not known. We generated transgenic (Tg) mice expressing the mouse PrP homolog of the FFI mutation. These mice synthesize a misfolded form of mutant PrP in their brains and develop a neurological illness with severe sleep disruption, highly reminiscent of FFI and different from that of analogously generated Tg(CJD) mice modeling CJD(178). No prion infectivity was detectable in Tg(FFI) and Tg(CJD) brains by bioassay or protein misfolding cyclic amplification, indicating that mutant PrP has disease-encoding properties that do not depend on its ability to propagate its misfolded conformation. Tg(FFI) and Tg(CJD) neurons have different patterns of intracellular PrP accumulation associated with distinct morphological abnormalities of the endoplasmic reticulum and Golgi, suggesting that mutation-specific alterations of secretory transport may contribute to the disease phenotype. |
format | Online Article Text |
id | pubmed-4400166 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2015 |
publisher | Public Library of Science |
record_format | MEDLINE/PubMed |
spelling | pubmed-44001662015-04-21 Transgenic Fatal Familial Insomnia Mice Indicate Prion Infectivity-Independent Mechanisms of Pathogenesis and Phenotypic Expression of Disease Bouybayoune, Ihssane Mantovani, Susanna Del Gallo, Federico Bertani, Ilaria Restelli, Elena Comerio, Liliana Tapella, Laura Baracchi, Francesca Fernández-Borges, Natalia Mangieri, Michela Bisighini, Cinzia Beznoussenko, Galina V. Paladini, Alessandra Balducci, Claudia Micotti, Edoardo Forloni, Gianluigi Castilla, Joaquín Fiordaliso, Fabio Tagliavini, Fabrizio Imeri, Luca Chiesa, Roberto PLoS Pathog Research Article Fatal familial insomnia (FFI) and a genetic form of Creutzfeldt-Jakob disease (CJD(178)) are clinically different prion disorders linked to the D178N prion protein (PrP) mutation. The disease phenotype is determined by the 129 M/V polymorphism on the mutant allele, which is thought to influence D178N PrP misfolding, leading to the formation of distinctive prion strains with specific neurotoxic properties. However, the mechanism by which misfolded variants of mutant PrP cause different diseases is not known. We generated transgenic (Tg) mice expressing the mouse PrP homolog of the FFI mutation. These mice synthesize a misfolded form of mutant PrP in their brains and develop a neurological illness with severe sleep disruption, highly reminiscent of FFI and different from that of analogously generated Tg(CJD) mice modeling CJD(178). No prion infectivity was detectable in Tg(FFI) and Tg(CJD) brains by bioassay or protein misfolding cyclic amplification, indicating that mutant PrP has disease-encoding properties that do not depend on its ability to propagate its misfolded conformation. Tg(FFI) and Tg(CJD) neurons have different patterns of intracellular PrP accumulation associated with distinct morphological abnormalities of the endoplasmic reticulum and Golgi, suggesting that mutation-specific alterations of secretory transport may contribute to the disease phenotype. Public Library of Science 2015-04-16 /pmc/articles/PMC4400166/ /pubmed/25880443 http://dx.doi.org/10.1371/journal.ppat.1004796 Text en © 2015 Bouybayoune et al http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are properly credited. |
spellingShingle | Research Article Bouybayoune, Ihssane Mantovani, Susanna Del Gallo, Federico Bertani, Ilaria Restelli, Elena Comerio, Liliana Tapella, Laura Baracchi, Francesca Fernández-Borges, Natalia Mangieri, Michela Bisighini, Cinzia Beznoussenko, Galina V. Paladini, Alessandra Balducci, Claudia Micotti, Edoardo Forloni, Gianluigi Castilla, Joaquín Fiordaliso, Fabio Tagliavini, Fabrizio Imeri, Luca Chiesa, Roberto Transgenic Fatal Familial Insomnia Mice Indicate Prion Infectivity-Independent Mechanisms of Pathogenesis and Phenotypic Expression of Disease |
title | Transgenic Fatal Familial Insomnia Mice Indicate Prion Infectivity-Independent Mechanisms of Pathogenesis and Phenotypic Expression of Disease |
title_full | Transgenic Fatal Familial Insomnia Mice Indicate Prion Infectivity-Independent Mechanisms of Pathogenesis and Phenotypic Expression of Disease |
title_fullStr | Transgenic Fatal Familial Insomnia Mice Indicate Prion Infectivity-Independent Mechanisms of Pathogenesis and Phenotypic Expression of Disease |
title_full_unstemmed | Transgenic Fatal Familial Insomnia Mice Indicate Prion Infectivity-Independent Mechanisms of Pathogenesis and Phenotypic Expression of Disease |
title_short | Transgenic Fatal Familial Insomnia Mice Indicate Prion Infectivity-Independent Mechanisms of Pathogenesis and Phenotypic Expression of Disease |
title_sort | transgenic fatal familial insomnia mice indicate prion infectivity-independent mechanisms of pathogenesis and phenotypic expression of disease |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4400166/ https://www.ncbi.nlm.nih.gov/pubmed/25880443 http://dx.doi.org/10.1371/journal.ppat.1004796 |
work_keys_str_mv | AT bouybayouneihssane transgenicfatalfamilialinsomniamiceindicateprioninfectivityindependentmechanismsofpathogenesisandphenotypicexpressionofdisease AT mantovanisusanna transgenicfatalfamilialinsomniamiceindicateprioninfectivityindependentmechanismsofpathogenesisandphenotypicexpressionofdisease AT delgallofederico transgenicfatalfamilialinsomniamiceindicateprioninfectivityindependentmechanismsofpathogenesisandphenotypicexpressionofdisease AT bertaniilaria transgenicfatalfamilialinsomniamiceindicateprioninfectivityindependentmechanismsofpathogenesisandphenotypicexpressionofdisease AT restellielena transgenicfatalfamilialinsomniamiceindicateprioninfectivityindependentmechanismsofpathogenesisandphenotypicexpressionofdisease AT comerioliliana transgenicfatalfamilialinsomniamiceindicateprioninfectivityindependentmechanismsofpathogenesisandphenotypicexpressionofdisease AT tapellalaura transgenicfatalfamilialinsomniamiceindicateprioninfectivityindependentmechanismsofpathogenesisandphenotypicexpressionofdisease AT baracchifrancesca transgenicfatalfamilialinsomniamiceindicateprioninfectivityindependentmechanismsofpathogenesisandphenotypicexpressionofdisease AT fernandezborgesnatalia transgenicfatalfamilialinsomniamiceindicateprioninfectivityindependentmechanismsofpathogenesisandphenotypicexpressionofdisease AT mangierimichela transgenicfatalfamilialinsomniamiceindicateprioninfectivityindependentmechanismsofpathogenesisandphenotypicexpressionofdisease AT bisighinicinzia transgenicfatalfamilialinsomniamiceindicateprioninfectivityindependentmechanismsofpathogenesisandphenotypicexpressionofdisease AT beznoussenkogalinav transgenicfatalfamilialinsomniamiceindicateprioninfectivityindependentmechanismsofpathogenesisandphenotypicexpressionofdisease AT paladinialessandra transgenicfatalfamilialinsomniamiceindicateprioninfectivityindependentmechanismsofpathogenesisandphenotypicexpressionofdisease AT balducciclaudia transgenicfatalfamilialinsomniamiceindicateprioninfectivityindependentmechanismsofpathogenesisandphenotypicexpressionofdisease AT micottiedoardo transgenicfatalfamilialinsomniamiceindicateprioninfectivityindependentmechanismsofpathogenesisandphenotypicexpressionofdisease AT forlonigianluigi transgenicfatalfamilialinsomniamiceindicateprioninfectivityindependentmechanismsofpathogenesisandphenotypicexpressionofdisease AT castillajoaquin transgenicfatalfamilialinsomniamiceindicateprioninfectivityindependentmechanismsofpathogenesisandphenotypicexpressionofdisease AT fiordalisofabio transgenicfatalfamilialinsomniamiceindicateprioninfectivityindependentmechanismsofpathogenesisandphenotypicexpressionofdisease AT tagliavinifabrizio transgenicfatalfamilialinsomniamiceindicateprioninfectivityindependentmechanismsofpathogenesisandphenotypicexpressionofdisease AT imeriluca transgenicfatalfamilialinsomniamiceindicateprioninfectivityindependentmechanismsofpathogenesisandphenotypicexpressionofdisease AT chiesaroberto transgenicfatalfamilialinsomniamiceindicateprioninfectivityindependentmechanismsofpathogenesisandphenotypicexpressionofdisease |