Cargando…

Cancerous inhibitor of protein phosphatase 2A (CIP2A) is an independent prognostic marker in wild-type KRAS metastatic colorectal cancer after colorectal liver metastasectomy

BACKGROUND: The impact of KRAS signaling on cancerous inhibitor of protein phosphatase 2A (CIP2A) expression has not yet been explored. We investigated the impact of KRAS on CIP2A expression in colorectal cancer patients after colorectal liver metastasectomy. METHODS: We examined CIP2A expression by...

Descripción completa

Detalles Bibliográficos
Autores principales: Chen, Kuen-Feng, Yen, Chueh-Chuan, Lin, Jen-Kou, Chen, Wei-Shone, Yang, Shung-Haur, Jiang, Jeng-Kai, Lan, Yuan-Tzu, Lin, Chun-Chi, Yu, Hui-Chuan, Hsu, Hui-Mei, Lin, Wen-Ling, Teng, Hao-Wei
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2015
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4404594/
https://www.ncbi.nlm.nih.gov/pubmed/25896895
http://dx.doi.org/10.1186/s12885-015-1300-3
_version_ 1782367518171594752
author Chen, Kuen-Feng
Yen, Chueh-Chuan
Lin, Jen-Kou
Chen, Wei-Shone
Yang, Shung-Haur
Jiang, Jeng-Kai
Lan, Yuan-Tzu
Lin, Chun-Chi
Yu, Hui-Chuan
Hsu, Hui-Mei
Lin, Wen-Ling
Teng, Hao-Wei
author_facet Chen, Kuen-Feng
Yen, Chueh-Chuan
Lin, Jen-Kou
Chen, Wei-Shone
Yang, Shung-Haur
Jiang, Jeng-Kai
Lan, Yuan-Tzu
Lin, Chun-Chi
Yu, Hui-Chuan
Hsu, Hui-Mei
Lin, Wen-Ling
Teng, Hao-Wei
author_sort Chen, Kuen-Feng
collection PubMed
description BACKGROUND: The impact of KRAS signaling on cancerous inhibitor of protein phosphatase 2A (CIP2A) expression has not yet been explored. We investigated the impact of KRAS on CIP2A expression in colorectal cancer patients after colorectal liver metastasectomy. METHODS: We examined CIP2A expression by immunohistochemistry (IHC) and used direct sequencing to identify the mutational status of KRAS exon 2 (codon 12 and 13). The association between CIP2A expression, KRAS genotype, clinicopathological parameters and survival were examined by the Kaplan–Meier method and the Cox proportional hazards model. A combination of immunoblotting and proliferation assays were employed to elucidate the role of CIP2A in signal transduction pathways in wild-type KRAS Caco-2 cells. RESULTS: A total of 220 colorectal cancer patients who had undergone colorectal liver metastasectomy were included in the study. The mutant KRAS genotype was associated with CIP2A overexpression. CIP2A expression was an independent prognostic marker in patients with wild-type KRAS metastatic colorectal cancer after colorectal liver metastasectomy (relative risk = 1.873, P = 0.019). Targeted silencing of CIP2A in Caco-2 cells (wild-type KRAS) led to decreased expression of pERK/ERK and decreased cell proliferation. Overexpression of mutant KRAS G12D in Caco-2 cells led to an increase in CIP2A expression and cell proliferation. In Caco-2 cells with the KRAS G12D, KRAS overexpression preserved the regulation effect of CIP2A in KRAS and abrogated the impact of CIP2A regulation on pERK/ERK and cell proliferation. CIP2A inhibition also increased the efficacy of cetuximab in Caco-2 cells. CONCLUSIONS: CIP2A is an independent prognostic marker in patients with wild-type KRAS metastatic colorectal cancer after colorectal liver metastasectomy.
format Online
Article
Text
id pubmed-4404594
institution National Center for Biotechnology Information
language English
publishDate 2015
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-44045942015-04-22 Cancerous inhibitor of protein phosphatase 2A (CIP2A) is an independent prognostic marker in wild-type KRAS metastatic colorectal cancer after colorectal liver metastasectomy Chen, Kuen-Feng Yen, Chueh-Chuan Lin, Jen-Kou Chen, Wei-Shone Yang, Shung-Haur Jiang, Jeng-Kai Lan, Yuan-Tzu Lin, Chun-Chi Yu, Hui-Chuan Hsu, Hui-Mei Lin, Wen-Ling Teng, Hao-Wei BMC Cancer Research Article BACKGROUND: The impact of KRAS signaling on cancerous inhibitor of protein phosphatase 2A (CIP2A) expression has not yet been explored. We investigated the impact of KRAS on CIP2A expression in colorectal cancer patients after colorectal liver metastasectomy. METHODS: We examined CIP2A expression by immunohistochemistry (IHC) and used direct sequencing to identify the mutational status of KRAS exon 2 (codon 12 and 13). The association between CIP2A expression, KRAS genotype, clinicopathological parameters and survival were examined by the Kaplan–Meier method and the Cox proportional hazards model. A combination of immunoblotting and proliferation assays were employed to elucidate the role of CIP2A in signal transduction pathways in wild-type KRAS Caco-2 cells. RESULTS: A total of 220 colorectal cancer patients who had undergone colorectal liver metastasectomy were included in the study. The mutant KRAS genotype was associated with CIP2A overexpression. CIP2A expression was an independent prognostic marker in patients with wild-type KRAS metastatic colorectal cancer after colorectal liver metastasectomy (relative risk = 1.873, P = 0.019). Targeted silencing of CIP2A in Caco-2 cells (wild-type KRAS) led to decreased expression of pERK/ERK and decreased cell proliferation. Overexpression of mutant KRAS G12D in Caco-2 cells led to an increase in CIP2A expression and cell proliferation. In Caco-2 cells with the KRAS G12D, KRAS overexpression preserved the regulation effect of CIP2A in KRAS and abrogated the impact of CIP2A regulation on pERK/ERK and cell proliferation. CIP2A inhibition also increased the efficacy of cetuximab in Caco-2 cells. CONCLUSIONS: CIP2A is an independent prognostic marker in patients with wild-type KRAS metastatic colorectal cancer after colorectal liver metastasectomy. BioMed Central 2015-04-17 /pmc/articles/PMC4404594/ /pubmed/25896895 http://dx.doi.org/10.1186/s12885-015-1300-3 Text en © Chen et al.; licensee BioMed Central. 2015 This article is published under license to BioMed Central Ltd. This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly credited. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research Article
Chen, Kuen-Feng
Yen, Chueh-Chuan
Lin, Jen-Kou
Chen, Wei-Shone
Yang, Shung-Haur
Jiang, Jeng-Kai
Lan, Yuan-Tzu
Lin, Chun-Chi
Yu, Hui-Chuan
Hsu, Hui-Mei
Lin, Wen-Ling
Teng, Hao-Wei
Cancerous inhibitor of protein phosphatase 2A (CIP2A) is an independent prognostic marker in wild-type KRAS metastatic colorectal cancer after colorectal liver metastasectomy
title Cancerous inhibitor of protein phosphatase 2A (CIP2A) is an independent prognostic marker in wild-type KRAS metastatic colorectal cancer after colorectal liver metastasectomy
title_full Cancerous inhibitor of protein phosphatase 2A (CIP2A) is an independent prognostic marker in wild-type KRAS metastatic colorectal cancer after colorectal liver metastasectomy
title_fullStr Cancerous inhibitor of protein phosphatase 2A (CIP2A) is an independent prognostic marker in wild-type KRAS metastatic colorectal cancer after colorectal liver metastasectomy
title_full_unstemmed Cancerous inhibitor of protein phosphatase 2A (CIP2A) is an independent prognostic marker in wild-type KRAS metastatic colorectal cancer after colorectal liver metastasectomy
title_short Cancerous inhibitor of protein phosphatase 2A (CIP2A) is an independent prognostic marker in wild-type KRAS metastatic colorectal cancer after colorectal liver metastasectomy
title_sort cancerous inhibitor of protein phosphatase 2a (cip2a) is an independent prognostic marker in wild-type kras metastatic colorectal cancer after colorectal liver metastasectomy
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4404594/
https://www.ncbi.nlm.nih.gov/pubmed/25896895
http://dx.doi.org/10.1186/s12885-015-1300-3
work_keys_str_mv AT chenkuenfeng cancerousinhibitorofproteinphosphatase2acip2aisanindependentprognosticmarkerinwildtypekrasmetastaticcolorectalcanceraftercolorectallivermetastasectomy
AT yenchuehchuan cancerousinhibitorofproteinphosphatase2acip2aisanindependentprognosticmarkerinwildtypekrasmetastaticcolorectalcanceraftercolorectallivermetastasectomy
AT linjenkou cancerousinhibitorofproteinphosphatase2acip2aisanindependentprognosticmarkerinwildtypekrasmetastaticcolorectalcanceraftercolorectallivermetastasectomy
AT chenweishone cancerousinhibitorofproteinphosphatase2acip2aisanindependentprognosticmarkerinwildtypekrasmetastaticcolorectalcanceraftercolorectallivermetastasectomy
AT yangshunghaur cancerousinhibitorofproteinphosphatase2acip2aisanindependentprognosticmarkerinwildtypekrasmetastaticcolorectalcanceraftercolorectallivermetastasectomy
AT jiangjengkai cancerousinhibitorofproteinphosphatase2acip2aisanindependentprognosticmarkerinwildtypekrasmetastaticcolorectalcanceraftercolorectallivermetastasectomy
AT lanyuantzu cancerousinhibitorofproteinphosphatase2acip2aisanindependentprognosticmarkerinwildtypekrasmetastaticcolorectalcanceraftercolorectallivermetastasectomy
AT linchunchi cancerousinhibitorofproteinphosphatase2acip2aisanindependentprognosticmarkerinwildtypekrasmetastaticcolorectalcanceraftercolorectallivermetastasectomy
AT yuhuichuan cancerousinhibitorofproteinphosphatase2acip2aisanindependentprognosticmarkerinwildtypekrasmetastaticcolorectalcanceraftercolorectallivermetastasectomy
AT hsuhuimei cancerousinhibitorofproteinphosphatase2acip2aisanindependentprognosticmarkerinwildtypekrasmetastaticcolorectalcanceraftercolorectallivermetastasectomy
AT linwenling cancerousinhibitorofproteinphosphatase2acip2aisanindependentprognosticmarkerinwildtypekrasmetastaticcolorectalcanceraftercolorectallivermetastasectomy
AT tenghaowei cancerousinhibitorofproteinphosphatase2acip2aisanindependentprognosticmarkerinwildtypekrasmetastaticcolorectalcanceraftercolorectallivermetastasectomy