Cargando…
Vitamin D Deficiency in Early Pregnancy
OBJECTIVE: Vitamin D deficiency is a common problem in reproductive-aged women in the United States. The effect of vitamin D deficiency in pregnancy is unknown, but has been associated with adverse pregnancy outcomes. The objective of this study was to analyze the relationship between vitamin D defi...
Autores principales: | , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Public Library of Science
2015
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4405493/ https://www.ncbi.nlm.nih.gov/pubmed/25898021 http://dx.doi.org/10.1371/journal.pone.0123763 |
_version_ | 1782367639889248256 |
---|---|
author | Flood-Nichols, Shannon K. Tinnemore, Deborah Huang, Raywin R. Napolitano, Peter G. Ippolito, Danielle L. |
author_facet | Flood-Nichols, Shannon K. Tinnemore, Deborah Huang, Raywin R. Napolitano, Peter G. Ippolito, Danielle L. |
author_sort | Flood-Nichols, Shannon K. |
collection | PubMed |
description | OBJECTIVE: Vitamin D deficiency is a common problem in reproductive-aged women in the United States. The effect of vitamin D deficiency in pregnancy is unknown, but has been associated with adverse pregnancy outcomes. The objective of this study was to analyze the relationship between vitamin D deficiency in the first trimester and subsequent clinical outcomes. STUDY DESIGN: This is a retrospective cohort study. Plasma was collected in the first trimester from 310 nulliparous women with singleton gestations without significant medical problems. Competitive enzymatic vitamin D assays were performed on banked plasma specimens and pregnancy outcomes were collected after delivery. Logistic regression was performed on patients stratified by plasma vitamin D concentration and the following combined clinical outcomes: preeclampsia, preterm delivery, intrauterine growth restriction, gestational diabetes, and spontaneous abortion. RESULTS: Vitamin D concentrations were obtained from 235 patients (mean age 24.3 years, range 18-40 years). Seventy percent of our study population was vitamin D insufficient with a serum concentration less than 30 ng/mL (mean serum concentration 27.6 ng/mL, range 13-71.6 ng/mL). Logistic regression was performed adjusting for age, race, body mass index, tobacco use, and time of year. Adverse pregnancy outcomes included preeclampsia, growth restriction, preterm delivery, gestational diabetes, and spontaneous abortion. There was no association between vitamin D deficiency and composite adverse pregnancy outcomes with an adjusted odds ratio of 1.01 (p value 0.738, 95% confidence intervals 0.961-1.057). CONCLUSION: Vitamin D deficiency did not associate with adverse pregnancy outcomes in this study population. However, the high percentage of affected individuals highlights the prevalence of vitamin D deficiency in young, reproductive-aged women. |
format | Online Article Text |
id | pubmed-4405493 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2015 |
publisher | Public Library of Science |
record_format | MEDLINE/PubMed |
spelling | pubmed-44054932015-05-07 Vitamin D Deficiency in Early Pregnancy Flood-Nichols, Shannon K. Tinnemore, Deborah Huang, Raywin R. Napolitano, Peter G. Ippolito, Danielle L. PLoS One Research Article OBJECTIVE: Vitamin D deficiency is a common problem in reproductive-aged women in the United States. The effect of vitamin D deficiency in pregnancy is unknown, but has been associated with adverse pregnancy outcomes. The objective of this study was to analyze the relationship between vitamin D deficiency in the first trimester and subsequent clinical outcomes. STUDY DESIGN: This is a retrospective cohort study. Plasma was collected in the first trimester from 310 nulliparous women with singleton gestations without significant medical problems. Competitive enzymatic vitamin D assays were performed on banked plasma specimens and pregnancy outcomes were collected after delivery. Logistic regression was performed on patients stratified by plasma vitamin D concentration and the following combined clinical outcomes: preeclampsia, preterm delivery, intrauterine growth restriction, gestational diabetes, and spontaneous abortion. RESULTS: Vitamin D concentrations were obtained from 235 patients (mean age 24.3 years, range 18-40 years). Seventy percent of our study population was vitamin D insufficient with a serum concentration less than 30 ng/mL (mean serum concentration 27.6 ng/mL, range 13-71.6 ng/mL). Logistic regression was performed adjusting for age, race, body mass index, tobacco use, and time of year. Adverse pregnancy outcomes included preeclampsia, growth restriction, preterm delivery, gestational diabetes, and spontaneous abortion. There was no association between vitamin D deficiency and composite adverse pregnancy outcomes with an adjusted odds ratio of 1.01 (p value 0.738, 95% confidence intervals 0.961-1.057). CONCLUSION: Vitamin D deficiency did not associate with adverse pregnancy outcomes in this study population. However, the high percentage of affected individuals highlights the prevalence of vitamin D deficiency in young, reproductive-aged women. Public Library of Science 2015-04-21 /pmc/articles/PMC4405493/ /pubmed/25898021 http://dx.doi.org/10.1371/journal.pone.0123763 Text en https://creativecommons.org/publicdomain/zero/1.0/ This is an open-access article distributed under the terms of the Creative Commons Public Domain declaration, which stipulates that, once placed in the public domain, this work may be freely reproduced, distributed, transmitted, modified, built upon, or otherwise used by anyone for any lawful purpose. |
spellingShingle | Research Article Flood-Nichols, Shannon K. Tinnemore, Deborah Huang, Raywin R. Napolitano, Peter G. Ippolito, Danielle L. Vitamin D Deficiency in Early Pregnancy |
title | Vitamin D Deficiency in Early Pregnancy |
title_full | Vitamin D Deficiency in Early Pregnancy |
title_fullStr | Vitamin D Deficiency in Early Pregnancy |
title_full_unstemmed | Vitamin D Deficiency in Early Pregnancy |
title_short | Vitamin D Deficiency in Early Pregnancy |
title_sort | vitamin d deficiency in early pregnancy |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4405493/ https://www.ncbi.nlm.nih.gov/pubmed/25898021 http://dx.doi.org/10.1371/journal.pone.0123763 |
work_keys_str_mv | AT floodnicholsshannonk vitaminddeficiencyinearlypregnancy AT tinnemoredeborah vitaminddeficiencyinearlypregnancy AT huangraywinr vitaminddeficiencyinearlypregnancy AT napolitanopeterg vitaminddeficiencyinearlypregnancy AT ippolitodaniellel vitaminddeficiencyinearlypregnancy |