Cargando…
Tomato juice intake increases resting energy expenditure and improves hypertriglyceridemia in middle-aged women: an open-label, single-arm study
BACKGROUND: Tomato-based food products have health-promoting and disease-preventing effects. Some tomato juice ingredients may have health benefits for middle-aged women, including women with menopausal symptoms and cardiovascular diseases. We investigated the net effect of tomato juice intake on se...
Autores principales: | , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2015
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4406031/ https://www.ncbi.nlm.nih.gov/pubmed/25880734 http://dx.doi.org/10.1186/s12937-015-0021-4 |
_version_ | 1782367710143840256 |
---|---|
author | Hirose, Asuka Terauchi, Masakazu Tamura, Moe Akiyoshi, Mihoko Owa, Yoko Kato, Kiyoko Kubota, Toshiro |
author_facet | Hirose, Asuka Terauchi, Masakazu Tamura, Moe Akiyoshi, Mihoko Owa, Yoko Kato, Kiyoko Kubota, Toshiro |
author_sort | Hirose, Asuka |
collection | PubMed |
description | BACKGROUND: Tomato-based food products have health-promoting and disease-preventing effects. Some tomato juice ingredients may have health benefits for middle-aged women, including women with menopausal symptoms and cardiovascular diseases. We investigated the net effect of tomato juice intake on several health parameters in women in this age group. METHODS: An open-label, single-arm study was conducted, involving 95 women (40-60-years-old) who had at least one menopausal symptom. The participants refrained from foods and drinks rich in tomato and tomato-based products for 2 weeks prior to the study and during the 8 weeks of tomato juice consumption. After the run-in period, the women were asked to consume 200 mL of unsalted tomato juice, twice daily for 8 weeks. Their menopausal symptoms were evaluated using the Menopausal Symptom Scale (MSS), Hospital Anxiety and Depression Scale (HADS), and Athens Insomnia Scale (AIS) before the study, and at 4 and 8 weeks after study commencement. At the same times, body composition; blood pressure; heart rate; resting energy expenditures (REEs); and serum levels of triglyceride (TG), cholesterol, glucose, and hemoglobin A1c were measured. RESULTS: Ninety-three women (98%) completed the study. The following parameters showed significant changes, compared with baseline, at study weeks 4 and 8 (mean ± standard deviation at baseline, week 4, and week 8): (1) the MSS score improved (9.9 ± 5.2, 8.5 ± 5.0, 8.3 ± 5.0; P < 0.0001, repeated measures analysis of variance(ANOVA)), (2) the HADS-anxiety subscale score improved (5.3 ± 2.7, 4.8 ± 2.4, 4.9 ± 2.9; P = 0.041, Friedman test), (3) heart rate increased (62.6 ± 9.4 bpm, 64.4 ± 8.6 bpm, 63.8 ± 8.2 bpm; P = 0.028, Friedman test), (4) REE increased (1980 ± 368 kcal/day, 2108 ± 440 kcal/day, 2149 ± 470 kcal/day; P = 0.0030, repeated measures ANOVA), (5) serum TG level decreased in the subgroup of women (n = 22) who had high TG (150 mg/dL or higher) at baseline (237.8 ± 88.9 mg/dL, 166.7 ± 86.1 mg/dL, 170.9 ± 109.7 mg/dL; P = 0.0002, Friedman test). CONCLUSIONS: Tomato juice intake alleviated menopausal symptoms, including anxiety, increased REEs and heart rate, and lowered high baseline serum TG levels in middle-aged women. TRIAL REGISTRATION: UMIN-CTRUMIN000011877. |
format | Online Article Text |
id | pubmed-4406031 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2015 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-44060312015-04-23 Tomato juice intake increases resting energy expenditure and improves hypertriglyceridemia in middle-aged women: an open-label, single-arm study Hirose, Asuka Terauchi, Masakazu Tamura, Moe Akiyoshi, Mihoko Owa, Yoko Kato, Kiyoko Kubota, Toshiro Nutr J Research BACKGROUND: Tomato-based food products have health-promoting and disease-preventing effects. Some tomato juice ingredients may have health benefits for middle-aged women, including women with menopausal symptoms and cardiovascular diseases. We investigated the net effect of tomato juice intake on several health parameters in women in this age group. METHODS: An open-label, single-arm study was conducted, involving 95 women (40-60-years-old) who had at least one menopausal symptom. The participants refrained from foods and drinks rich in tomato and tomato-based products for 2 weeks prior to the study and during the 8 weeks of tomato juice consumption. After the run-in period, the women were asked to consume 200 mL of unsalted tomato juice, twice daily for 8 weeks. Their menopausal symptoms were evaluated using the Menopausal Symptom Scale (MSS), Hospital Anxiety and Depression Scale (HADS), and Athens Insomnia Scale (AIS) before the study, and at 4 and 8 weeks after study commencement. At the same times, body composition; blood pressure; heart rate; resting energy expenditures (REEs); and serum levels of triglyceride (TG), cholesterol, glucose, and hemoglobin A1c were measured. RESULTS: Ninety-three women (98%) completed the study. The following parameters showed significant changes, compared with baseline, at study weeks 4 and 8 (mean ± standard deviation at baseline, week 4, and week 8): (1) the MSS score improved (9.9 ± 5.2, 8.5 ± 5.0, 8.3 ± 5.0; P < 0.0001, repeated measures analysis of variance(ANOVA)), (2) the HADS-anxiety subscale score improved (5.3 ± 2.7, 4.8 ± 2.4, 4.9 ± 2.9; P = 0.041, Friedman test), (3) heart rate increased (62.6 ± 9.4 bpm, 64.4 ± 8.6 bpm, 63.8 ± 8.2 bpm; P = 0.028, Friedman test), (4) REE increased (1980 ± 368 kcal/day, 2108 ± 440 kcal/day, 2149 ± 470 kcal/day; P = 0.0030, repeated measures ANOVA), (5) serum TG level decreased in the subgroup of women (n = 22) who had high TG (150 mg/dL or higher) at baseline (237.8 ± 88.9 mg/dL, 166.7 ± 86.1 mg/dL, 170.9 ± 109.7 mg/dL; P = 0.0002, Friedman test). CONCLUSIONS: Tomato juice intake alleviated menopausal symptoms, including anxiety, increased REEs and heart rate, and lowered high baseline serum TG levels in middle-aged women. TRIAL REGISTRATION: UMIN-CTRUMIN000011877. BioMed Central 2015-04-08 /pmc/articles/PMC4406031/ /pubmed/25880734 http://dx.doi.org/10.1186/s12937-015-0021-4 Text en © Hirose et al.; licensee BioMed Central. 2015 This article is published under license to BioMed Central Ltd. This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly credited. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Research Hirose, Asuka Terauchi, Masakazu Tamura, Moe Akiyoshi, Mihoko Owa, Yoko Kato, Kiyoko Kubota, Toshiro Tomato juice intake increases resting energy expenditure and improves hypertriglyceridemia in middle-aged women: an open-label, single-arm study |
title | Tomato juice intake increases resting energy expenditure and improves hypertriglyceridemia in middle-aged women: an open-label, single-arm study |
title_full | Tomato juice intake increases resting energy expenditure and improves hypertriglyceridemia in middle-aged women: an open-label, single-arm study |
title_fullStr | Tomato juice intake increases resting energy expenditure and improves hypertriglyceridemia in middle-aged women: an open-label, single-arm study |
title_full_unstemmed | Tomato juice intake increases resting energy expenditure and improves hypertriglyceridemia in middle-aged women: an open-label, single-arm study |
title_short | Tomato juice intake increases resting energy expenditure and improves hypertriglyceridemia in middle-aged women: an open-label, single-arm study |
title_sort | tomato juice intake increases resting energy expenditure and improves hypertriglyceridemia in middle-aged women: an open-label, single-arm study |
topic | Research |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4406031/ https://www.ncbi.nlm.nih.gov/pubmed/25880734 http://dx.doi.org/10.1186/s12937-015-0021-4 |
work_keys_str_mv | AT hiroseasuka tomatojuiceintakeincreasesrestingenergyexpenditureandimproveshypertriglyceridemiainmiddleagedwomenanopenlabelsinglearmstudy AT terauchimasakazu tomatojuiceintakeincreasesrestingenergyexpenditureandimproveshypertriglyceridemiainmiddleagedwomenanopenlabelsinglearmstudy AT tamuramoe tomatojuiceintakeincreasesrestingenergyexpenditureandimproveshypertriglyceridemiainmiddleagedwomenanopenlabelsinglearmstudy AT akiyoshimihoko tomatojuiceintakeincreasesrestingenergyexpenditureandimproveshypertriglyceridemiainmiddleagedwomenanopenlabelsinglearmstudy AT owayoko tomatojuiceintakeincreasesrestingenergyexpenditureandimproveshypertriglyceridemiainmiddleagedwomenanopenlabelsinglearmstudy AT katokiyoko tomatojuiceintakeincreasesrestingenergyexpenditureandimproveshypertriglyceridemiainmiddleagedwomenanopenlabelsinglearmstudy AT kubotatoshiro tomatojuiceintakeincreasesrestingenergyexpenditureandimproveshypertriglyceridemiainmiddleagedwomenanopenlabelsinglearmstudy |