Incidence and characteristics of vitamin D deficiency rickets in New Zealand children: a prospective New Zealand paediatric surveillance unit study

Detalles Bibliográficos
Autores principales: Wheeler, Benjamin, Dickson, Nigel, Houghton, Lisa, Ward, Leanne, Taylor, Barry
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2015
Materias:
Poster Presentation
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4428863/
http://dx.doi.org/10.1186/1687-9856-2015-S1-P57
_version_ 1782370954728439808
author Wheeler, Benjamin
Dickson, Nigel
Houghton, Lisa
Ward, Leanne
Taylor, Barry
author_facet Wheeler, Benjamin
Dickson, Nigel
Houghton, Lisa
Ward, Leanne
Taylor, Barry
author_sort Wheeler, Benjamin
collection PubMed
description
format Online
Article
Text
id pubmed-4428863
institution National Center for Biotechnology Information
language English
publishDate 2015
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-44288632015-05-18 Incidence and characteristics of vitamin D deficiency rickets in New Zealand children: a prospective New Zealand paediatric surveillance unit study Wheeler, Benjamin Dickson, Nigel Houghton, Lisa Ward, Leanne Taylor, Barry Int J Pediatr Endocrinol Poster Presentation BioMed Central 2015 2015-04-28 /pmc/articles/PMC4428863/ http://dx.doi.org/10.1186/1687-9856-2015-S1-P57 Text en Copyright © 2015 Wheeler et al; licensee BioMed Central Ltd. http://creativecommons.org/licenses/by/4.0 This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Poster Presentation
Wheeler, Benjamin
Dickson, Nigel
Houghton, Lisa
Ward, Leanne
Taylor, Barry
Incidence and characteristics of vitamin D deficiency rickets in New Zealand children: a prospective New Zealand paediatric surveillance unit study
title Incidence and characteristics of vitamin D deficiency rickets in New Zealand children: a prospective New Zealand paediatric surveillance unit study
title_full Incidence and characteristics of vitamin D deficiency rickets in New Zealand children: a prospective New Zealand paediatric surveillance unit study
title_fullStr Incidence and characteristics of vitamin D deficiency rickets in New Zealand children: a prospective New Zealand paediatric surveillance unit study
title_full_unstemmed Incidence and characteristics of vitamin D deficiency rickets in New Zealand children: a prospective New Zealand paediatric surveillance unit study
title_short Incidence and characteristics of vitamin D deficiency rickets in New Zealand children: a prospective New Zealand paediatric surveillance unit study
title_sort incidence and characteristics of vitamin d deficiency rickets in new zealand children: a prospective new zealand paediatric surveillance unit study
topic Poster Presentation
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4428863/
http://dx.doi.org/10.1186/1687-9856-2015-S1-P57
work_keys_str_mv AT wheelerbenjamin incidenceandcharacteristicsofvitaminddeficiencyricketsinnewzealandchildrenaprospectivenewzealandpaediatricsurveillanceunitstudy
AT dicksonnigel incidenceandcharacteristicsofvitaminddeficiencyricketsinnewzealandchildrenaprospectivenewzealandpaediatricsurveillanceunitstudy
AT houghtonlisa incidenceandcharacteristicsofvitaminddeficiencyricketsinnewzealandchildrenaprospectivenewzealandpaediatricsurveillanceunitstudy
AT wardleanne incidenceandcharacteristicsofvitaminddeficiencyricketsinnewzealandchildrenaprospectivenewzealandpaediatricsurveillanceunitstudy
AT taylorbarry incidenceandcharacteristicsofvitaminddeficiencyricketsinnewzealandchildrenaprospectivenewzealandpaediatricsurveillanceunitstudy

Ejemplares similares