Cargando…
Response to vitamin d replacement in overweight and normal weight children with vitamin D deficiency
| Autores principales: | , , |
|---|---|
| Formato: | Online Artículo Texto |
| Lenguaje: | English |
| Publicado: |
BioMed Central
2015
|
| Materias: | |
| Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4429099/ http://dx.doi.org/10.1186/1687-9856-2015-S1-P76 |
| _version_ | 1782370981946327040 |
|---|---|
| author | Kim, Haejung Chung, In Hyuk Yoo, Eun-Gyong |
| author_facet | Kim, Haejung Chung, In Hyuk Yoo, Eun-Gyong |
| author_sort | Kim, Haejung |
| collection | PubMed |
| description | |
| format | Online Article Text |
| id | pubmed-4429099 |
| institution | National Center for Biotechnology Information |
| language | English |
| publishDate | 2015 |
| publisher | BioMed Central |
| record_format | MEDLINE/PubMed |
| spelling | pubmed-44290992015-05-15 Response to vitamin d replacement in overweight and normal weight children with vitamin D deficiency Kim, Haejung Chung, In Hyuk Yoo, Eun-Gyong Int J Pediatr Endocrinol Poster Presentation BioMed Central 2015 2015-04-28 /pmc/articles/PMC4429099/ http://dx.doi.org/10.1186/1687-9856-2015-S1-P76 Text en Copyright © 2015 Kim et al; licensee BioMed Central Ltd. http://creativecommons.org/licenses/by/4.0 This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
| spellingShingle | Poster Presentation Kim, Haejung Chung, In Hyuk Yoo, Eun-Gyong Response to vitamin d replacement in overweight and normal weight children with vitamin D deficiency |
| title | Response to vitamin d replacement in overweight and normal weight children with vitamin D deficiency |
| title_full | Response to vitamin d replacement in overweight and normal weight children with vitamin D deficiency |
| title_fullStr | Response to vitamin d replacement in overweight and normal weight children with vitamin D deficiency |
| title_full_unstemmed | Response to vitamin d replacement in overweight and normal weight children with vitamin D deficiency |
| title_short | Response to vitamin d replacement in overweight and normal weight children with vitamin D deficiency |
| title_sort | response to vitamin d replacement in overweight and normal weight children with vitamin d deficiency |
| topic | Poster Presentation |
| url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4429099/ http://dx.doi.org/10.1186/1687-9856-2015-S1-P76 |
| work_keys_str_mv | AT kimhaejung responsetovitamindreplacementinoverweightandnormalweightchildrenwithvitaminddeficiency AT chunginhyuk responsetovitamindreplacementinoverweightandnormalweightchildrenwithvitaminddeficiency AT yooeungyong responsetovitamindreplacementinoverweightandnormalweightchildrenwithvitaminddeficiency |