Cargando…

ANGPTL3 is a novel biomarker as it activates ERK/MAPK pathway in oral cancer

Angiopoietin-like 3 (ANGPTL3), which is involved in new blood vessel growth and stimulation of mitogen-activated protein kinase (MAPK), is expressed aberrantly in several types of human cancers. However, little is known about the relevance of ANGPTL3 in the behavior of oral squamous cell carcinoma (...

Descripción completa

Detalles Bibliográficos
Autores principales: Koyama, Tomoyoshi, Ogawara, Katsunori, Kasamatsu, Atsushi, Okamoto, Atsushi, Kasama, Hiroki, Minakawa, Yasuyuki, Shimada, Ken, Yokoe, Hidetaka, Shiiba, Masashi, Tanzawa, Hideki, Uzawa, Katsuhiro
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BlackWell Publishing Ltd 2015
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4430268/
https://www.ncbi.nlm.nih.gov/pubmed/25644496
http://dx.doi.org/10.1002/cam4.418
_version_ 1782371158414327808
author Koyama, Tomoyoshi
Ogawara, Katsunori
Kasamatsu, Atsushi
Okamoto, Atsushi
Kasama, Hiroki
Minakawa, Yasuyuki
Shimada, Ken
Yokoe, Hidetaka
Shiiba, Masashi
Tanzawa, Hideki
Uzawa, Katsuhiro
author_facet Koyama, Tomoyoshi
Ogawara, Katsunori
Kasamatsu, Atsushi
Okamoto, Atsushi
Kasama, Hiroki
Minakawa, Yasuyuki
Shimada, Ken
Yokoe, Hidetaka
Shiiba, Masashi
Tanzawa, Hideki
Uzawa, Katsuhiro
author_sort Koyama, Tomoyoshi
collection PubMed
description Angiopoietin-like 3 (ANGPTL3), which is involved in new blood vessel growth and stimulation of mitogen-activated protein kinase (MAPK), is expressed aberrantly in several types of human cancers. However, little is known about the relevance of ANGPTL3 in the behavior of oral squamous cell carcinoma (OSCC). In this study, we evaluated ANGPTL3 mRNA and protein in OSCC-derived cell lines (n = 8) and primary OSCCs (n = 109) and assessed the effect of ANGPTL3 on the biology and function of OSCCs in vitro and in vivo. Significant (P < 0.05) ANGPTL3 upregulation was detected in the cell lines and most primary OSCCs (60%) compared with the normal counterparts. The ANGPTL3 expression level was correlated closely (P < 0.05) with tumoral size. In patients with T3/T4 tumors, the overall survival rate with an ANGPTL3-positive tumor was significantly (P < 0.05) lower than that of ANGPTL3-negative cases. In vitro, cellular growth in ANGPTL3 knockdown cells significantly (P < 0.05) decreased with inactivated extracellular regulated kinase (ERK) and cell-cycle arrest at the G1 phase resulting from upregulation of the cyclin-dependent kinase inhibitors, including p21(Cip1) and p27(Kip1). We also observed a marked (P < 0.05) reduction in the growth in ANGPTL3 knockdown-cell xenografts with decreased levels of phosphorylated ERK relative to control-cell xenografts. The current data indicated that ANGPTL3 may play a role in OSCCs via MAPK signaling cascades, making it a potentially useful diagnostic/therapeutic target for use in patients with OSCC.
format Online
Article
Text
id pubmed-4430268
institution National Center for Biotechnology Information
language English
publishDate 2015
publisher BlackWell Publishing Ltd
record_format MEDLINE/PubMed
spelling pubmed-44302682015-05-18 ANGPTL3 is a novel biomarker as it activates ERK/MAPK pathway in oral cancer Koyama, Tomoyoshi Ogawara, Katsunori Kasamatsu, Atsushi Okamoto, Atsushi Kasama, Hiroki Minakawa, Yasuyuki Shimada, Ken Yokoe, Hidetaka Shiiba, Masashi Tanzawa, Hideki Uzawa, Katsuhiro Cancer Med Cancer Biology Angiopoietin-like 3 (ANGPTL3), which is involved in new blood vessel growth and stimulation of mitogen-activated protein kinase (MAPK), is expressed aberrantly in several types of human cancers. However, little is known about the relevance of ANGPTL3 in the behavior of oral squamous cell carcinoma (OSCC). In this study, we evaluated ANGPTL3 mRNA and protein in OSCC-derived cell lines (n = 8) and primary OSCCs (n = 109) and assessed the effect of ANGPTL3 on the biology and function of OSCCs in vitro and in vivo. Significant (P < 0.05) ANGPTL3 upregulation was detected in the cell lines and most primary OSCCs (60%) compared with the normal counterparts. The ANGPTL3 expression level was correlated closely (P < 0.05) with tumoral size. In patients with T3/T4 tumors, the overall survival rate with an ANGPTL3-positive tumor was significantly (P < 0.05) lower than that of ANGPTL3-negative cases. In vitro, cellular growth in ANGPTL3 knockdown cells significantly (P < 0.05) decreased with inactivated extracellular regulated kinase (ERK) and cell-cycle arrest at the G1 phase resulting from upregulation of the cyclin-dependent kinase inhibitors, including p21(Cip1) and p27(Kip1). We also observed a marked (P < 0.05) reduction in the growth in ANGPTL3 knockdown-cell xenografts with decreased levels of phosphorylated ERK relative to control-cell xenografts. The current data indicated that ANGPTL3 may play a role in OSCCs via MAPK signaling cascades, making it a potentially useful diagnostic/therapeutic target for use in patients with OSCC. BlackWell Publishing Ltd 2015-05 2015-01-30 /pmc/articles/PMC4430268/ /pubmed/25644496 http://dx.doi.org/10.1002/cam4.418 Text en © 2015 The Authors. Cancer Medicine published by John Wiley & Sons Ltd. http://creativecommons.org/licenses/by/4.0/ This is an open access article under the terms of the Creative Commons Attribution License, which permits use, distribution and reproduction in any medium, provided the original work is properly cited.
spellingShingle Cancer Biology
Koyama, Tomoyoshi
Ogawara, Katsunori
Kasamatsu, Atsushi
Okamoto, Atsushi
Kasama, Hiroki
Minakawa, Yasuyuki
Shimada, Ken
Yokoe, Hidetaka
Shiiba, Masashi
Tanzawa, Hideki
Uzawa, Katsuhiro
ANGPTL3 is a novel biomarker as it activates ERK/MAPK pathway in oral cancer
title ANGPTL3 is a novel biomarker as it activates ERK/MAPK pathway in oral cancer
title_full ANGPTL3 is a novel biomarker as it activates ERK/MAPK pathway in oral cancer
title_fullStr ANGPTL3 is a novel biomarker as it activates ERK/MAPK pathway in oral cancer
title_full_unstemmed ANGPTL3 is a novel biomarker as it activates ERK/MAPK pathway in oral cancer
title_short ANGPTL3 is a novel biomarker as it activates ERK/MAPK pathway in oral cancer
title_sort angptl3 is a novel biomarker as it activates erk/mapk pathway in oral cancer
topic Cancer Biology
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4430268/
https://www.ncbi.nlm.nih.gov/pubmed/25644496
http://dx.doi.org/10.1002/cam4.418
work_keys_str_mv AT koyamatomoyoshi angptl3isanovelbiomarkerasitactivateserkmapkpathwayinoralcancer
AT ogawarakatsunori angptl3isanovelbiomarkerasitactivateserkmapkpathwayinoralcancer
AT kasamatsuatsushi angptl3isanovelbiomarkerasitactivateserkmapkpathwayinoralcancer
AT okamotoatsushi angptl3isanovelbiomarkerasitactivateserkmapkpathwayinoralcancer
AT kasamahiroki angptl3isanovelbiomarkerasitactivateserkmapkpathwayinoralcancer
AT minakawayasuyuki angptl3isanovelbiomarkerasitactivateserkmapkpathwayinoralcancer
AT shimadaken angptl3isanovelbiomarkerasitactivateserkmapkpathwayinoralcancer
AT yokoehidetaka angptl3isanovelbiomarkerasitactivateserkmapkpathwayinoralcancer
AT shiibamasashi angptl3isanovelbiomarkerasitactivateserkmapkpathwayinoralcancer
AT tanzawahideki angptl3isanovelbiomarkerasitactivateserkmapkpathwayinoralcancer
AT uzawakatsuhiro angptl3isanovelbiomarkerasitactivateserkmapkpathwayinoralcancer