Cargando…

How an online survey on the treatment of allergic rhinitis and its impact on asthma (ARIA) detected specialty-specific knowledge-gaps

BACKGROUND: To enhance the dissemination of the ARIA document (Allergic rhinitis (AR) and its impact on asthma) in Mexico, a Working Group composed of 35 specialists of 8 professional medical societies developed a transculturized ARIA México 2014 guideline. The ARIA guidelines use the GRADE system,...

Descripción completa

Detalles Bibliográficos
Autores principales: Larenas Linnemann, Désirée ES, Medina Ávalos, Miguel Alejandro, Lozano Sáenz, José
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2015
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4436974/
https://www.ncbi.nlm.nih.gov/pubmed/26023324
http://dx.doi.org/10.1186/s40413-015-0064-1
_version_ 1782372163356983296
author Larenas Linnemann, Désirée ES
Medina Ávalos, Miguel Alejandro
Lozano Sáenz, José
author_facet Larenas Linnemann, Désirée ES
Medina Ávalos, Miguel Alejandro
Lozano Sáenz, José
author_sort Larenas Linnemann, Désirée ES
collection PubMed
description BACKGROUND: To enhance the dissemination of the ARIA document (Allergic rhinitis (AR) and its impact on asthma) in Mexico, a Working Group composed of 35 specialists of 8 professional medical societies developed a transculturized ARIA México 2014 guideline. The ARIA guidelines use the GRADE system, which builds recommendations and suggestions around clinical questions (CQ). METHODS: As part of the dissemination strategy and to detect the physicians’ view and knowledge-gaps concerning the treatment of AR an online survey was sent out to members of participating societies containing the CQ of ARIA México. Replies were analyzed per specialty against the ARIA México 2014 experts’ recommendations/suggestions; differences between specialties were analyzed with Pearson’s Chi-squares. RESULTS: 807 surveys were returned, 657 completed (81%). We analyze replies from 158 alergists, 188 ENTs, 64 pulmonologists, 220 pediatricians and 177 GPs/family doctors. More than half of the surveyed physicians of all specialties would give an allergen reduced diet to pregnant/lactating women and avoid pets at home, which is against ARIA experts’ suggestions. ARIA experts suggest intranasal antihistamines can be part of the AR treatment: 46-63% of the ENTs, pulmonologists and pediatricians disagree; and experts prefer oral H1-antihistamines over leukotriene receptor antagonists (LTRA) for the treatment of AR: 52-36% of the pulmonologists, pediatricians and GPs prefer LTRAs. Concerning glucocorticosteroids (GCS): GPs are more reluctant to use intranasal GCS (p < 0.001) and 47% prefers oral H1-antihistamines. As for the treatment of recalcitrant AR ARIA experts suggest the use of oral, but not intramuscular, GCS: a quarter of pulmonologists, pediatricians and GPs considers they should not be used. Contrarily, 40% of ENTs favors intramuscular GCS. In patients with AR and comorbid asthma several physicians of all specialties –except pulmonologists- erroneously considers antihistamines, intranasal GCS and LTRAs useful for the treatment of asthma, while first-line recommended asthma treatment is inhaled GCS. CONCLUSION: On certain issues in the treatment of AR the physicians’ opinion diverges from the recommendations/suggestions of ARIA experts. Moreover, physicians’ opinions depend on their specialty. As such, an online survey can help to detect knowledge-gaps and guide the development of more focused and specialty-specific postgraduate learning tools. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s40413-015-0064-1) contains supplementary material, which is available to authorized users.
format Online
Article
Text
id pubmed-4436974
institution National Center for Biotechnology Information
language English
publishDate 2015
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-44369742015-05-28 How an online survey on the treatment of allergic rhinitis and its impact on asthma (ARIA) detected specialty-specific knowledge-gaps Larenas Linnemann, Désirée ES Medina Ávalos, Miguel Alejandro Lozano Sáenz, José World Allergy Organ J Original Research BACKGROUND: To enhance the dissemination of the ARIA document (Allergic rhinitis (AR) and its impact on asthma) in Mexico, a Working Group composed of 35 specialists of 8 professional medical societies developed a transculturized ARIA México 2014 guideline. The ARIA guidelines use the GRADE system, which builds recommendations and suggestions around clinical questions (CQ). METHODS: As part of the dissemination strategy and to detect the physicians’ view and knowledge-gaps concerning the treatment of AR an online survey was sent out to members of participating societies containing the CQ of ARIA México. Replies were analyzed per specialty against the ARIA México 2014 experts’ recommendations/suggestions; differences between specialties were analyzed with Pearson’s Chi-squares. RESULTS: 807 surveys were returned, 657 completed (81%). We analyze replies from 158 alergists, 188 ENTs, 64 pulmonologists, 220 pediatricians and 177 GPs/family doctors. More than half of the surveyed physicians of all specialties would give an allergen reduced diet to pregnant/lactating women and avoid pets at home, which is against ARIA experts’ suggestions. ARIA experts suggest intranasal antihistamines can be part of the AR treatment: 46-63% of the ENTs, pulmonologists and pediatricians disagree; and experts prefer oral H1-antihistamines over leukotriene receptor antagonists (LTRA) for the treatment of AR: 52-36% of the pulmonologists, pediatricians and GPs prefer LTRAs. Concerning glucocorticosteroids (GCS): GPs are more reluctant to use intranasal GCS (p < 0.001) and 47% prefers oral H1-antihistamines. As for the treatment of recalcitrant AR ARIA experts suggest the use of oral, but not intramuscular, GCS: a quarter of pulmonologists, pediatricians and GPs considers they should not be used. Contrarily, 40% of ENTs favors intramuscular GCS. In patients with AR and comorbid asthma several physicians of all specialties –except pulmonologists- erroneously considers antihistamines, intranasal GCS and LTRAs useful for the treatment of asthma, while first-line recommended asthma treatment is inhaled GCS. CONCLUSION: On certain issues in the treatment of AR the physicians’ opinion diverges from the recommendations/suggestions of ARIA experts. Moreover, physicians’ opinions depend on their specialty. As such, an online survey can help to detect knowledge-gaps and guide the development of more focused and specialty-specific postgraduate learning tools. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s40413-015-0064-1) contains supplementary material, which is available to authorized users. BioMed Central 2015-05-19 /pmc/articles/PMC4436974/ /pubmed/26023324 http://dx.doi.org/10.1186/s40413-015-0064-1 Text en © Larenas Linnemann et al.; licensee BioMed Central. 2015 This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly credited. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Original Research
Larenas Linnemann, Désirée ES
Medina Ávalos, Miguel Alejandro
Lozano Sáenz, José
How an online survey on the treatment of allergic rhinitis and its impact on asthma (ARIA) detected specialty-specific knowledge-gaps
title How an online survey on the treatment of allergic rhinitis and its impact on asthma (ARIA) detected specialty-specific knowledge-gaps
title_full How an online survey on the treatment of allergic rhinitis and its impact on asthma (ARIA) detected specialty-specific knowledge-gaps
title_fullStr How an online survey on the treatment of allergic rhinitis and its impact on asthma (ARIA) detected specialty-specific knowledge-gaps
title_full_unstemmed How an online survey on the treatment of allergic rhinitis and its impact on asthma (ARIA) detected specialty-specific knowledge-gaps
title_short How an online survey on the treatment of allergic rhinitis and its impact on asthma (ARIA) detected specialty-specific knowledge-gaps
title_sort how an online survey on the treatment of allergic rhinitis and its impact on asthma (aria) detected specialty-specific knowledge-gaps
topic Original Research
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4436974/
https://www.ncbi.nlm.nih.gov/pubmed/26023324
http://dx.doi.org/10.1186/s40413-015-0064-1
work_keys_str_mv AT larenaslinnemanndesireees howanonlinesurveyonthetreatmentofallergicrhinitisanditsimpactonasthmaariadetectedspecialtyspecificknowledgegaps
AT medinaavalosmiguelalejandro howanonlinesurveyonthetreatmentofallergicrhinitisanditsimpactonasthmaariadetectedspecialtyspecificknowledgegaps
AT lozanosaenzjose howanonlinesurveyonthetreatmentofallergicrhinitisanditsimpactonasthmaariadetectedspecialtyspecificknowledgegaps