Cargando…

Antitumor and Antimicrobial Activity of Some Cyclic Tetrapeptides and Tripeptides Derived from Marine Bacteria

Marine derived cyclo(Gly-l-Ser-l-Pro-l-Glu) was selected as a lead to evaluate antitumor-antibiotic activity. Histidine was chosen to replace the serine residue to form cyclo(Gly-l-His-l-Pro-l-Glu). Cyclic tetrapeptides (CtetPs) were then synthesized using a solution phase method, and subjected to a...

Descripción completa

Detalles Bibliográficos
Autores principales: Chakraborty, Subrata, Tai, Dar-Fu, Lin, Yi-Chun, Chiou, Tzyy-Wen
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2015
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4446616/
https://www.ncbi.nlm.nih.gov/pubmed/25988520
http://dx.doi.org/10.3390/md13053029
_version_ 1782373465263702016
author Chakraborty, Subrata
Tai, Dar-Fu
Lin, Yi-Chun
Chiou, Tzyy-Wen
author_facet Chakraborty, Subrata
Tai, Dar-Fu
Lin, Yi-Chun
Chiou, Tzyy-Wen
author_sort Chakraborty, Subrata
collection PubMed
description Marine derived cyclo(Gly-l-Ser-l-Pro-l-Glu) was selected as a lead to evaluate antitumor-antibiotic activity. Histidine was chosen to replace the serine residue to form cyclo(Gly-l-His-l-Pro-l-Glu). Cyclic tetrapeptides (CtetPs) were then synthesized using a solution phase method, and subjected to antitumor and antibiotic assays. The benzyl group protected CtetPs derivatives, showed better activity against antibiotic-resistant Staphylococcus aureus in the range of 60–120 μM. Benzyl group protected CtetPs 3 and 4, exhibited antitumor activity against several cell lines at a concentration of 80–108 μM. However, shortening the size of the ring to the cyclic tripeptide (CtriP) scaffold, cyclo(Gly-l-Ser-l-Pro), cyclo(Ser-l-Pro-l-Glu) and their analogues showed no antibiotic or antitumor activity. This phenomenon can be explained from their backbone structures.
format Online
Article
Text
id pubmed-4446616
institution National Center for Biotechnology Information
language English
publishDate 2015
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-44466162015-05-29 Antitumor and Antimicrobial Activity of Some Cyclic Tetrapeptides and Tripeptides Derived from Marine Bacteria Chakraborty, Subrata Tai, Dar-Fu Lin, Yi-Chun Chiou, Tzyy-Wen Mar Drugs Article Marine derived cyclo(Gly-l-Ser-l-Pro-l-Glu) was selected as a lead to evaluate antitumor-antibiotic activity. Histidine was chosen to replace the serine residue to form cyclo(Gly-l-His-l-Pro-l-Glu). Cyclic tetrapeptides (CtetPs) were then synthesized using a solution phase method, and subjected to antitumor and antibiotic assays. The benzyl group protected CtetPs derivatives, showed better activity against antibiotic-resistant Staphylococcus aureus in the range of 60–120 μM. Benzyl group protected CtetPs 3 and 4, exhibited antitumor activity against several cell lines at a concentration of 80–108 μM. However, shortening the size of the ring to the cyclic tripeptide (CtriP) scaffold, cyclo(Gly-l-Ser-l-Pro), cyclo(Ser-l-Pro-l-Glu) and their analogues showed no antibiotic or antitumor activity. This phenomenon can be explained from their backbone structures. MDPI 2015-05-15 /pmc/articles/PMC4446616/ /pubmed/25988520 http://dx.doi.org/10.3390/md13053029 Text en © 2015 by the authors; licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution license (http://creativecommons.org/licenses/by/4.0/).
spellingShingle Article
Chakraborty, Subrata
Tai, Dar-Fu
Lin, Yi-Chun
Chiou, Tzyy-Wen
Antitumor and Antimicrobial Activity of Some Cyclic Tetrapeptides and Tripeptides Derived from Marine Bacteria
title Antitumor and Antimicrobial Activity of Some Cyclic Tetrapeptides and Tripeptides Derived from Marine Bacteria
title_full Antitumor and Antimicrobial Activity of Some Cyclic Tetrapeptides and Tripeptides Derived from Marine Bacteria
title_fullStr Antitumor and Antimicrobial Activity of Some Cyclic Tetrapeptides and Tripeptides Derived from Marine Bacteria
title_full_unstemmed Antitumor and Antimicrobial Activity of Some Cyclic Tetrapeptides and Tripeptides Derived from Marine Bacteria
title_short Antitumor and Antimicrobial Activity of Some Cyclic Tetrapeptides and Tripeptides Derived from Marine Bacteria
title_sort antitumor and antimicrobial activity of some cyclic tetrapeptides and tripeptides derived from marine bacteria
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4446616/
https://www.ncbi.nlm.nih.gov/pubmed/25988520
http://dx.doi.org/10.3390/md13053029
work_keys_str_mv AT chakrabortysubrata antitumorandantimicrobialactivityofsomecyclictetrapeptidesandtripeptidesderivedfrommarinebacteria
AT taidarfu antitumorandantimicrobialactivityofsomecyclictetrapeptidesandtripeptidesderivedfrommarinebacteria
AT linyichun antitumorandantimicrobialactivityofsomecyclictetrapeptidesandtripeptidesderivedfrommarinebacteria
AT chioutzyywen antitumorandantimicrobialactivityofsomecyclictetrapeptidesandtripeptidesderivedfrommarinebacteria