Cargando…
Antitumor and Antimicrobial Activity of Some Cyclic Tetrapeptides and Tripeptides Derived from Marine Bacteria
Marine derived cyclo(Gly-l-Ser-l-Pro-l-Glu) was selected as a lead to evaluate antitumor-antibiotic activity. Histidine was chosen to replace the serine residue to form cyclo(Gly-l-His-l-Pro-l-Glu). Cyclic tetrapeptides (CtetPs) were then synthesized using a solution phase method, and subjected to a...
Autores principales: | , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
MDPI
2015
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4446616/ https://www.ncbi.nlm.nih.gov/pubmed/25988520 http://dx.doi.org/10.3390/md13053029 |
_version_ | 1782373465263702016 |
---|---|
author | Chakraborty, Subrata Tai, Dar-Fu Lin, Yi-Chun Chiou, Tzyy-Wen |
author_facet | Chakraborty, Subrata Tai, Dar-Fu Lin, Yi-Chun Chiou, Tzyy-Wen |
author_sort | Chakraborty, Subrata |
collection | PubMed |
description | Marine derived cyclo(Gly-l-Ser-l-Pro-l-Glu) was selected as a lead to evaluate antitumor-antibiotic activity. Histidine was chosen to replace the serine residue to form cyclo(Gly-l-His-l-Pro-l-Glu). Cyclic tetrapeptides (CtetPs) were then synthesized using a solution phase method, and subjected to antitumor and antibiotic assays. The benzyl group protected CtetPs derivatives, showed better activity against antibiotic-resistant Staphylococcus aureus in the range of 60–120 μM. Benzyl group protected CtetPs 3 and 4, exhibited antitumor activity against several cell lines at a concentration of 80–108 μM. However, shortening the size of the ring to the cyclic tripeptide (CtriP) scaffold, cyclo(Gly-l-Ser-l-Pro), cyclo(Ser-l-Pro-l-Glu) and their analogues showed no antibiotic or antitumor activity. This phenomenon can be explained from their backbone structures. |
format | Online Article Text |
id | pubmed-4446616 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2015 |
publisher | MDPI |
record_format | MEDLINE/PubMed |
spelling | pubmed-44466162015-05-29 Antitumor and Antimicrobial Activity of Some Cyclic Tetrapeptides and Tripeptides Derived from Marine Bacteria Chakraborty, Subrata Tai, Dar-Fu Lin, Yi-Chun Chiou, Tzyy-Wen Mar Drugs Article Marine derived cyclo(Gly-l-Ser-l-Pro-l-Glu) was selected as a lead to evaluate antitumor-antibiotic activity. Histidine was chosen to replace the serine residue to form cyclo(Gly-l-His-l-Pro-l-Glu). Cyclic tetrapeptides (CtetPs) were then synthesized using a solution phase method, and subjected to antitumor and antibiotic assays. The benzyl group protected CtetPs derivatives, showed better activity against antibiotic-resistant Staphylococcus aureus in the range of 60–120 μM. Benzyl group protected CtetPs 3 and 4, exhibited antitumor activity against several cell lines at a concentration of 80–108 μM. However, shortening the size of the ring to the cyclic tripeptide (CtriP) scaffold, cyclo(Gly-l-Ser-l-Pro), cyclo(Ser-l-Pro-l-Glu) and their analogues showed no antibiotic or antitumor activity. This phenomenon can be explained from their backbone structures. MDPI 2015-05-15 /pmc/articles/PMC4446616/ /pubmed/25988520 http://dx.doi.org/10.3390/md13053029 Text en © 2015 by the authors; licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution license (http://creativecommons.org/licenses/by/4.0/). |
spellingShingle | Article Chakraborty, Subrata Tai, Dar-Fu Lin, Yi-Chun Chiou, Tzyy-Wen Antitumor and Antimicrobial Activity of Some Cyclic Tetrapeptides and Tripeptides Derived from Marine Bacteria |
title | Antitumor and Antimicrobial Activity of Some Cyclic Tetrapeptides and Tripeptides Derived from Marine Bacteria |
title_full | Antitumor and Antimicrobial Activity of Some Cyclic Tetrapeptides and Tripeptides Derived from Marine Bacteria |
title_fullStr | Antitumor and Antimicrobial Activity of Some Cyclic Tetrapeptides and Tripeptides Derived from Marine Bacteria |
title_full_unstemmed | Antitumor and Antimicrobial Activity of Some Cyclic Tetrapeptides and Tripeptides Derived from Marine Bacteria |
title_short | Antitumor and Antimicrobial Activity of Some Cyclic Tetrapeptides and Tripeptides Derived from Marine Bacteria |
title_sort | antitumor and antimicrobial activity of some cyclic tetrapeptides and tripeptides derived from marine bacteria |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4446616/ https://www.ncbi.nlm.nih.gov/pubmed/25988520 http://dx.doi.org/10.3390/md13053029 |
work_keys_str_mv | AT chakrabortysubrata antitumorandantimicrobialactivityofsomecyclictetrapeptidesandtripeptidesderivedfrommarinebacteria AT taidarfu antitumorandantimicrobialactivityofsomecyclictetrapeptidesandtripeptidesderivedfrommarinebacteria AT linyichun antitumorandantimicrobialactivityofsomecyclictetrapeptidesandtripeptidesderivedfrommarinebacteria AT chioutzyywen antitumorandantimicrobialactivityofsomecyclictetrapeptidesandtripeptidesderivedfrommarinebacteria |