Cargando…
Approaches and impact of non-academic research capacity strengthening training models in sub-Saharan Africa: a systematic review
BACKGROUND: Research is essential to identify and prioritize health needs and to develop appropriate strategies to improve health outcomes. In the last decade, non-academic research capacity strengthening trainings in sub-Saharan Africa, coupled with developing research infrastructure and the provis...
Autores principales: | , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2015
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4464866/ https://www.ncbi.nlm.nih.gov/pubmed/26055974 http://dx.doi.org/10.1186/s12961-015-0017-8 |
_version_ | 1782376039999078400 |
---|---|
author | Mugabo, Lambert Rouleau, Dominique Odhiambo, Jackline Nisingizwe, Marie Paul Amoroso, Cheryl Barebwanuwe, Peter Warugaba, Christine Habumugisha, Lameck Hedt-Gauthier, Bethany L. |
author_facet | Mugabo, Lambert Rouleau, Dominique Odhiambo, Jackline Nisingizwe, Marie Paul Amoroso, Cheryl Barebwanuwe, Peter Warugaba, Christine Habumugisha, Lameck Hedt-Gauthier, Bethany L. |
author_sort | Mugabo, Lambert |
collection | PubMed |
description | BACKGROUND: Research is essential to identify and prioritize health needs and to develop appropriate strategies to improve health outcomes. In the last decade, non-academic research capacity strengthening trainings in sub-Saharan Africa, coupled with developing research infrastructure and the provision of individual mentorship support, has been used to build health worker skills. The objectives of this review are to describe different training approaches to research capacity strengthening in sub-Saharan Africa outside academic programs, assess methods used to evaluate research capacity strengthening activities, and learn about the challenges facing research capacity strengthening and the strategies/innovations required to overcome them. METHODOLOGY: The PubMed database was searched using nine search terms and articles were included if 1) they explicitly described research capacity strengthening training activities, including information on program duration, target audience, immediate program outputs and outcomes; 2) all or part of the training program took place in sub-Saharan African countries; 3) the training activities were not a formal academic program; 4) papers were published between 2000 and 2013; and 5) both abstract and full paper were available in English. RESULTS: The search resulted in 495 articles, of which 450 were retained; 14 papers met all inclusion criteria and were included and analysed. In total, 4136 people were trained, of which 2939 were from Africa. Of the 14 included papers, six fell in the category of short-term evaluation period and eight in the long-term evaluation period. Conduct of evaluations and use of evaluation frameworks varied between short and long term models and some trainings were not evaluated. Evaluation methods included tests, surveys, interviews, and systems approach matrix. CONCLUSIONS: Research capacity strengthening activities in sub-Saharan Africa outside of academic settings provide important contributions to developing in-country capacity to participate in and lead research. Institutional support, increased funds, and dedicated time for research activities are critical factors that lead to the development of successful programs. Further, knowledge sharing through scientific articles with sufficient detail is needed to enable replication of successful models in other settings. |
format | Online Article Text |
id | pubmed-4464866 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2015 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-44648662015-06-14 Approaches and impact of non-academic research capacity strengthening training models in sub-Saharan Africa: a systematic review Mugabo, Lambert Rouleau, Dominique Odhiambo, Jackline Nisingizwe, Marie Paul Amoroso, Cheryl Barebwanuwe, Peter Warugaba, Christine Habumugisha, Lameck Hedt-Gauthier, Bethany L. Health Res Policy Syst Review BACKGROUND: Research is essential to identify and prioritize health needs and to develop appropriate strategies to improve health outcomes. In the last decade, non-academic research capacity strengthening trainings in sub-Saharan Africa, coupled with developing research infrastructure and the provision of individual mentorship support, has been used to build health worker skills. The objectives of this review are to describe different training approaches to research capacity strengthening in sub-Saharan Africa outside academic programs, assess methods used to evaluate research capacity strengthening activities, and learn about the challenges facing research capacity strengthening and the strategies/innovations required to overcome them. METHODOLOGY: The PubMed database was searched using nine search terms and articles were included if 1) they explicitly described research capacity strengthening training activities, including information on program duration, target audience, immediate program outputs and outcomes; 2) all or part of the training program took place in sub-Saharan African countries; 3) the training activities were not a formal academic program; 4) papers were published between 2000 and 2013; and 5) both abstract and full paper were available in English. RESULTS: The search resulted in 495 articles, of which 450 were retained; 14 papers met all inclusion criteria and were included and analysed. In total, 4136 people were trained, of which 2939 were from Africa. Of the 14 included papers, six fell in the category of short-term evaluation period and eight in the long-term evaluation period. Conduct of evaluations and use of evaluation frameworks varied between short and long term models and some trainings were not evaluated. Evaluation methods included tests, surveys, interviews, and systems approach matrix. CONCLUSIONS: Research capacity strengthening activities in sub-Saharan Africa outside of academic settings provide important contributions to developing in-country capacity to participate in and lead research. Institutional support, increased funds, and dedicated time for research activities are critical factors that lead to the development of successful programs. Further, knowledge sharing through scientific articles with sufficient detail is needed to enable replication of successful models in other settings. BioMed Central 2015-06-09 /pmc/articles/PMC4464866/ /pubmed/26055974 http://dx.doi.org/10.1186/s12961-015-0017-8 Text en © Mugabo et al. 2015 This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly credited. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Review Mugabo, Lambert Rouleau, Dominique Odhiambo, Jackline Nisingizwe, Marie Paul Amoroso, Cheryl Barebwanuwe, Peter Warugaba, Christine Habumugisha, Lameck Hedt-Gauthier, Bethany L. Approaches and impact of non-academic research capacity strengthening training models in sub-Saharan Africa: a systematic review |
title | Approaches and impact of non-academic research capacity strengthening training models in sub-Saharan Africa: a systematic review |
title_full | Approaches and impact of non-academic research capacity strengthening training models in sub-Saharan Africa: a systematic review |
title_fullStr | Approaches and impact of non-academic research capacity strengthening training models in sub-Saharan Africa: a systematic review |
title_full_unstemmed | Approaches and impact of non-academic research capacity strengthening training models in sub-Saharan Africa: a systematic review |
title_short | Approaches and impact of non-academic research capacity strengthening training models in sub-Saharan Africa: a systematic review |
title_sort | approaches and impact of non-academic research capacity strengthening training models in sub-saharan africa: a systematic review |
topic | Review |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4464866/ https://www.ncbi.nlm.nih.gov/pubmed/26055974 http://dx.doi.org/10.1186/s12961-015-0017-8 |
work_keys_str_mv | AT mugabolambert approachesandimpactofnonacademicresearchcapacitystrengtheningtrainingmodelsinsubsaharanafricaasystematicreview AT rouleaudominique approachesandimpactofnonacademicresearchcapacitystrengtheningtrainingmodelsinsubsaharanafricaasystematicreview AT odhiambojackline approachesandimpactofnonacademicresearchcapacitystrengtheningtrainingmodelsinsubsaharanafricaasystematicreview AT nisingizwemariepaul approachesandimpactofnonacademicresearchcapacitystrengtheningtrainingmodelsinsubsaharanafricaasystematicreview AT amorosocheryl approachesandimpactofnonacademicresearchcapacitystrengtheningtrainingmodelsinsubsaharanafricaasystematicreview AT barebwanuwepeter approachesandimpactofnonacademicresearchcapacitystrengtheningtrainingmodelsinsubsaharanafricaasystematicreview AT warugabachristine approachesandimpactofnonacademicresearchcapacitystrengtheningtrainingmodelsinsubsaharanafricaasystematicreview AT habumugishalameck approachesandimpactofnonacademicresearchcapacitystrengtheningtrainingmodelsinsubsaharanafricaasystematicreview AT hedtgauthierbethanyl approachesandimpactofnonacademicresearchcapacitystrengtheningtrainingmodelsinsubsaharanafricaasystematicreview |