Cargando…
Biomarkers in sepsis: a systematic review
Autores principales: | , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2015
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4470932/ http://dx.doi.org/10.1186/cc14130 |
_version_ | 1782376822701293568 |
---|---|
author | Morriello, F Marshall, J |
author_facet | Morriello, F Marshall, J |
author_sort | Morriello, F |
collection | PubMed |
description | |
format | Online Article Text |
id | pubmed-4470932 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2015 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-44709322015-06-29 Biomarkers in sepsis: a systematic review Morriello, F Marshall, J Crit Care Poster Presentation BioMed Central 2015 2015-03-16 /pmc/articles/PMC4470932/ http://dx.doi.org/10.1186/cc14130 Text en Copyright © 2015 Morriello and Marshall; licensee BioMed Central Ltd. http://creativecommons.org/licenses/by/4.0 This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Poster Presentation Morriello, F Marshall, J Biomarkers in sepsis: a systematic review |
title | Biomarkers in sepsis: a systematic review |
title_full | Biomarkers in sepsis: a systematic review |
title_fullStr | Biomarkers in sepsis: a systematic review |
title_full_unstemmed | Biomarkers in sepsis: a systematic review |
title_short | Biomarkers in sepsis: a systematic review |
title_sort | biomarkers in sepsis: a systematic review |
topic | Poster Presentation |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4470932/ http://dx.doi.org/10.1186/cc14130 |
work_keys_str_mv | AT morriellof biomarkersinsepsisasystematicreview AT marshallj biomarkersinsepsisasystematicreview |