Cargando…

High multiple carriage and emergence of Streptococcus pneumoniae vaccine serotype variants in Malawian children

BACKGROUND: Carriage of either single or multiple pneumococcal serotypes (multiple carriage) is a prerequisite for developing invasive pneumococcal disease. However, despite the reported high rates of pneumococcal carriage in Malawi, no data on carriage of multiple serotypes has been reported previo...

Descripción completa

Detalles Bibliográficos
Autores principales: Kamng’ona, Arox W., Hinds, Jason, Bar-Zeev, Naor, Gould, Katherine A., Chaguza, Chrispin, Msefula, Chisomo, Cornick, Jennifer E., Kulohoma, Benard W., Gray, Katherine, Bentley, Stephen D., French, Neil, Heyderman, Robert S., Everett, Dean B.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2015
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4474563/
https://www.ncbi.nlm.nih.gov/pubmed/26088623
http://dx.doi.org/10.1186/s12879-015-0980-2
_version_ 1782377291930664960
author Kamng’ona, Arox W.
Hinds, Jason
Bar-Zeev, Naor
Gould, Katherine A.
Chaguza, Chrispin
Msefula, Chisomo
Cornick, Jennifer E.
Kulohoma, Benard W.
Gray, Katherine
Bentley, Stephen D.
French, Neil
Heyderman, Robert S.
Everett, Dean B.
author_facet Kamng’ona, Arox W.
Hinds, Jason
Bar-Zeev, Naor
Gould, Katherine A.
Chaguza, Chrispin
Msefula, Chisomo
Cornick, Jennifer E.
Kulohoma, Benard W.
Gray, Katherine
Bentley, Stephen D.
French, Neil
Heyderman, Robert S.
Everett, Dean B.
author_sort Kamng’ona, Arox W.
collection PubMed
description BACKGROUND: Carriage of either single or multiple pneumococcal serotypes (multiple carriage) is a prerequisite for developing invasive pneumococcal disease. However, despite the reported high rates of pneumococcal carriage in Malawi, no data on carriage of multiple serotypes has been reported previously. Our study provides the first description of the prevalence of multiple pneumococcal carriage in Malawi. METHODS: The study was conducted in Blantyre and Karonga districts in Malawi, from 2008 to 2012. We recruited 116 children aged 0–13 years. These children were either HIV-infected (N = 44) or uninfected (N = 72). Nasopharyngeal samples were collected using sterile swabs. Pneumococcal serotypes in the samples were identified by microarray. Strains that could not be typed by microarray were sequenced to characterise possible genetic alterations within the capsular polysaccharide (CPS) locus. RESULTS: The microarray identified 179 pneumococcal strains (from 116 subjects), encompassing 43 distinct serotypes and non-typeable (NT) strains. Forty per cent (46/116) of children carried multiple serotypes. Carriage of vaccine type (VT) strains was higher (p = 0.028) in younger (0–2 years) children (71 %, 40/56) compared to older (3–13 years) children (50 %, 30/60). Genetic variations within the CPS locus of known serotypes were observed in 19 % (34/179) of the strains identified. The variants included 13-valent pneumococcal conjugate vaccine (PCV13) serotypes 6B and 19A, and the polysaccharide vaccine serotype 20. Serotype 6B variants were the most frequently isolated (47 %, 16/34). Unlike the wild type, the CPS locus of the 6B variants contained an insertion of the licD-family phosphotransferase gene. The CPS locus of 19A- and 20-variants contained an inversion in the sugar-biosynthesis (rmlD) gene and a 717 bp deletion within the transferase (whaF) gene, respectively. CONCLUSIONS: The high multiple carriage in Malawian children provides opportunities for genetic exchange through horizontal gene transfer. This may potentially lead to CPS locus variants and vaccine escape. Variants reported here occurred naturally, however, PCV13 introduction could exacerbate the CPS genetic variations. Further studies are therefore recommended to assess the invasive potential of these variants and establish whether PCV13 would offer cross-protection. We have shown that younger children (0–2 years) are a reservoir of VT serotypes, which makes them an ideal target for vaccination.
format Online
Article
Text
id pubmed-4474563
institution National Center for Biotechnology Information
language English
publishDate 2015
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-44745632015-06-20 High multiple carriage and emergence of Streptococcus pneumoniae vaccine serotype variants in Malawian children Kamng’ona, Arox W. Hinds, Jason Bar-Zeev, Naor Gould, Katherine A. Chaguza, Chrispin Msefula, Chisomo Cornick, Jennifer E. Kulohoma, Benard W. Gray, Katherine Bentley, Stephen D. French, Neil Heyderman, Robert S. Everett, Dean B. BMC Infect Dis Research Article BACKGROUND: Carriage of either single or multiple pneumococcal serotypes (multiple carriage) is a prerequisite for developing invasive pneumococcal disease. However, despite the reported high rates of pneumococcal carriage in Malawi, no data on carriage of multiple serotypes has been reported previously. Our study provides the first description of the prevalence of multiple pneumococcal carriage in Malawi. METHODS: The study was conducted in Blantyre and Karonga districts in Malawi, from 2008 to 2012. We recruited 116 children aged 0–13 years. These children were either HIV-infected (N = 44) or uninfected (N = 72). Nasopharyngeal samples were collected using sterile swabs. Pneumococcal serotypes in the samples were identified by microarray. Strains that could not be typed by microarray were sequenced to characterise possible genetic alterations within the capsular polysaccharide (CPS) locus. RESULTS: The microarray identified 179 pneumococcal strains (from 116 subjects), encompassing 43 distinct serotypes and non-typeable (NT) strains. Forty per cent (46/116) of children carried multiple serotypes. Carriage of vaccine type (VT) strains was higher (p = 0.028) in younger (0–2 years) children (71 %, 40/56) compared to older (3–13 years) children (50 %, 30/60). Genetic variations within the CPS locus of known serotypes were observed in 19 % (34/179) of the strains identified. The variants included 13-valent pneumococcal conjugate vaccine (PCV13) serotypes 6B and 19A, and the polysaccharide vaccine serotype 20. Serotype 6B variants were the most frequently isolated (47 %, 16/34). Unlike the wild type, the CPS locus of the 6B variants contained an insertion of the licD-family phosphotransferase gene. The CPS locus of 19A- and 20-variants contained an inversion in the sugar-biosynthesis (rmlD) gene and a 717 bp deletion within the transferase (whaF) gene, respectively. CONCLUSIONS: The high multiple carriage in Malawian children provides opportunities for genetic exchange through horizontal gene transfer. This may potentially lead to CPS locus variants and vaccine escape. Variants reported here occurred naturally, however, PCV13 introduction could exacerbate the CPS genetic variations. Further studies are therefore recommended to assess the invasive potential of these variants and establish whether PCV13 would offer cross-protection. We have shown that younger children (0–2 years) are a reservoir of VT serotypes, which makes them an ideal target for vaccination. BioMed Central 2015-06-20 /pmc/articles/PMC4474563/ /pubmed/26088623 http://dx.doi.org/10.1186/s12879-015-0980-2 Text en © Kamng'ona et al. 2015 This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly credited. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research Article
Kamng’ona, Arox W.
Hinds, Jason
Bar-Zeev, Naor
Gould, Katherine A.
Chaguza, Chrispin
Msefula, Chisomo
Cornick, Jennifer E.
Kulohoma, Benard W.
Gray, Katherine
Bentley, Stephen D.
French, Neil
Heyderman, Robert S.
Everett, Dean B.
High multiple carriage and emergence of Streptococcus pneumoniae vaccine serotype variants in Malawian children
title High multiple carriage and emergence of Streptococcus pneumoniae vaccine serotype variants in Malawian children
title_full High multiple carriage and emergence of Streptococcus pneumoniae vaccine serotype variants in Malawian children
title_fullStr High multiple carriage and emergence of Streptococcus pneumoniae vaccine serotype variants in Malawian children
title_full_unstemmed High multiple carriage and emergence of Streptococcus pneumoniae vaccine serotype variants in Malawian children
title_short High multiple carriage and emergence of Streptococcus pneumoniae vaccine serotype variants in Malawian children
title_sort high multiple carriage and emergence of streptococcus pneumoniae vaccine serotype variants in malawian children
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4474563/
https://www.ncbi.nlm.nih.gov/pubmed/26088623
http://dx.doi.org/10.1186/s12879-015-0980-2
work_keys_str_mv AT kamngonaaroxw highmultiplecarriageandemergenceofstreptococcuspneumoniaevaccineserotypevariantsinmalawianchildren
AT hindsjason highmultiplecarriageandemergenceofstreptococcuspneumoniaevaccineserotypevariantsinmalawianchildren
AT barzeevnaor highmultiplecarriageandemergenceofstreptococcuspneumoniaevaccineserotypevariantsinmalawianchildren
AT gouldkatherinea highmultiplecarriageandemergenceofstreptococcuspneumoniaevaccineserotypevariantsinmalawianchildren
AT chaguzachrispin highmultiplecarriageandemergenceofstreptococcuspneumoniaevaccineserotypevariantsinmalawianchildren
AT msefulachisomo highmultiplecarriageandemergenceofstreptococcuspneumoniaevaccineserotypevariantsinmalawianchildren
AT cornickjennifere highmultiplecarriageandemergenceofstreptococcuspneumoniaevaccineserotypevariantsinmalawianchildren
AT kulohomabenardw highmultiplecarriageandemergenceofstreptococcuspneumoniaevaccineserotypevariantsinmalawianchildren
AT graykatherine highmultiplecarriageandemergenceofstreptococcuspneumoniaevaccineserotypevariantsinmalawianchildren
AT bentleystephend highmultiplecarriageandemergenceofstreptococcuspneumoniaevaccineserotypevariantsinmalawianchildren
AT frenchneil highmultiplecarriageandemergenceofstreptococcuspneumoniaevaccineserotypevariantsinmalawianchildren
AT heydermanroberts highmultiplecarriageandemergenceofstreptococcuspneumoniaevaccineserotypevariantsinmalawianchildren
AT everettdeanb highmultiplecarriageandemergenceofstreptococcuspneumoniaevaccineserotypevariantsinmalawianchildren