Cargando…
Study of genetic variability in Vitis vinifera L. germplasm by high-throughput Vitis18kSNP array: the case of Georgian genetic resources
BACKGROUND: Georgia, in the Caucasian region, is considered the first domestication centre of grapevine. This country is characterized by high morphological variability of cultivated (Vitis vinifera L. subsp. sativa (DC.) Hegi) and wild (Vitis vinifera L. subsp. sylvestris (Gmel.) Hegi) compartments...
Autores principales: | , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2015
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4477415/ https://www.ncbi.nlm.nih.gov/pubmed/26099513 http://dx.doi.org/10.1186/s12870-015-0510-9 |
_version_ | 1782377756019916800 |
---|---|
author | De Lorenzis, Gabriella Chipashvili, Ramaz Failla, Osvaldo Maghradze, David |
author_facet | De Lorenzis, Gabriella Chipashvili, Ramaz Failla, Osvaldo Maghradze, David |
author_sort | De Lorenzis, Gabriella |
collection | PubMed |
description | BACKGROUND: Georgia, in the Caucasian region, is considered the first domestication centre of grapevine. This country is characterized by high morphological variability of cultivated (Vitis vinifera L. subsp. sativa (DC.) Hegi) and wild (Vitis vinifera L. subsp. sylvestris (Gmel.) Hegi) compartments. The main objective of this study was to investigate the level of genetic diversity obtained by the novel custom Vitis18kSNP array, in order to analyse 71 grapevine accessions representative of wild and cultivated Georgian germplasms. RESULTS: The number of loci successfully amplified was 15,317 out of 18,775 SNP and 79 % of loci resulted polymorphic. Sixty-eight unique profiles were identified, 42 for the sativa and 26 for the sylvestris compartment. Cluster analysis highlighted two main groups, one for cultivars and another for wild individuals, while a genetic structure according to accession taxonomic status and cultivar geographical origin was revealed by multivariate analysis, differentiating clearly the genotypes into 3 main groups, two groups including cultivars and one for wild individuals, even though a considerable overlapping area was observed. CONCLUSIONS: Pattern of genetic diversity structure presented an additional proof that grapevine domestication events took place in the Caucasian region contributing to the crop evolution. Our results demonstrated a moderate differentiation between sativa and sylvestris compartments, even though a connection between several samples of both subspecies may be assumed for the occurrence of cross hybridization events among native wild populations and the cultivated accessions. Nevertheless, first degree relationships have not been discovered between wild and cultivated individuals. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s12870-015-0510-9) contains supplementary material, which is available to authorized users. |
format | Online Article Text |
id | pubmed-4477415 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2015 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-44774152015-06-24 Study of genetic variability in Vitis vinifera L. germplasm by high-throughput Vitis18kSNP array: the case of Georgian genetic resources De Lorenzis, Gabriella Chipashvili, Ramaz Failla, Osvaldo Maghradze, David BMC Plant Biol Research Article BACKGROUND: Georgia, in the Caucasian region, is considered the first domestication centre of grapevine. This country is characterized by high morphological variability of cultivated (Vitis vinifera L. subsp. sativa (DC.) Hegi) and wild (Vitis vinifera L. subsp. sylvestris (Gmel.) Hegi) compartments. The main objective of this study was to investigate the level of genetic diversity obtained by the novel custom Vitis18kSNP array, in order to analyse 71 grapevine accessions representative of wild and cultivated Georgian germplasms. RESULTS: The number of loci successfully amplified was 15,317 out of 18,775 SNP and 79 % of loci resulted polymorphic. Sixty-eight unique profiles were identified, 42 for the sativa and 26 for the sylvestris compartment. Cluster analysis highlighted two main groups, one for cultivars and another for wild individuals, while a genetic structure according to accession taxonomic status and cultivar geographical origin was revealed by multivariate analysis, differentiating clearly the genotypes into 3 main groups, two groups including cultivars and one for wild individuals, even though a considerable overlapping area was observed. CONCLUSIONS: Pattern of genetic diversity structure presented an additional proof that grapevine domestication events took place in the Caucasian region contributing to the crop evolution. Our results demonstrated a moderate differentiation between sativa and sylvestris compartments, even though a connection between several samples of both subspecies may be assumed for the occurrence of cross hybridization events among native wild populations and the cultivated accessions. Nevertheless, first degree relationships have not been discovered between wild and cultivated individuals. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s12870-015-0510-9) contains supplementary material, which is available to authorized users. BioMed Central 2015-06-23 /pmc/articles/PMC4477415/ /pubmed/26099513 http://dx.doi.org/10.1186/s12870-015-0510-9 Text en © Lorenzis et al. 2015 This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly credited. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Research Article De Lorenzis, Gabriella Chipashvili, Ramaz Failla, Osvaldo Maghradze, David Study of genetic variability in Vitis vinifera L. germplasm by high-throughput Vitis18kSNP array: the case of Georgian genetic resources |
title | Study of genetic variability in Vitis vinifera L. germplasm by high-throughput Vitis18kSNP array: the case of Georgian genetic resources |
title_full | Study of genetic variability in Vitis vinifera L. germplasm by high-throughput Vitis18kSNP array: the case of Georgian genetic resources |
title_fullStr | Study of genetic variability in Vitis vinifera L. germplasm by high-throughput Vitis18kSNP array: the case of Georgian genetic resources |
title_full_unstemmed | Study of genetic variability in Vitis vinifera L. germplasm by high-throughput Vitis18kSNP array: the case of Georgian genetic resources |
title_short | Study of genetic variability in Vitis vinifera L. germplasm by high-throughput Vitis18kSNP array: the case of Georgian genetic resources |
title_sort | study of genetic variability in vitis vinifera l. germplasm by high-throughput vitis18ksnp array: the case of georgian genetic resources |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4477415/ https://www.ncbi.nlm.nih.gov/pubmed/26099513 http://dx.doi.org/10.1186/s12870-015-0510-9 |
work_keys_str_mv | AT delorenzisgabriella studyofgeneticvariabilityinvitisviniferalgermplasmbyhighthroughputvitis18ksnparraythecaseofgeorgiangeneticresources AT chipashviliramaz studyofgeneticvariabilityinvitisviniferalgermplasmbyhighthroughputvitis18ksnparraythecaseofgeorgiangeneticresources AT faillaosvaldo studyofgeneticvariabilityinvitisviniferalgermplasmbyhighthroughputvitis18ksnparraythecaseofgeorgiangeneticresources AT maghradzedavid studyofgeneticvariabilityinvitisviniferalgermplasmbyhighthroughputvitis18ksnparraythecaseofgeorgiangeneticresources |