Cargando…
Integrated genomics has identified a new AT/RT-like yet INI1-positive brain tumor subtype among primary pediatric embryonal tumors
BACKGROUND: Pediatric embryonal brain tumors (PEBTs), which encompass medulloblastoma (MB), primitive neuroectodermal tumor (PNET) and atypical teratoid/rhabdoid tumor (AT/RT), are the second most prevalent pediatric brain tumor type. AT/RT is highly malignant and is often misdiagnosed as MB or PNET...
Autores principales: | , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2015
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4480900/ https://www.ncbi.nlm.nih.gov/pubmed/26109171 http://dx.doi.org/10.1186/s12920-015-0103-3 |
_version_ | 1782378209448296448 |
---|---|
author | Ho, Donald Ming-Tak Shih, Chuan-Chi Liang, Muh-Lii Tsai, Chan-Yen Hsieh, Tsung-Han Tsai, Chin-Han Lin, Shih-Chieh Chang, Ting-Yu Chao, Meng-En Wang, Hsei-Wei Wong, Tai-Tong |
author_facet | Ho, Donald Ming-Tak Shih, Chuan-Chi Liang, Muh-Lii Tsai, Chan-Yen Hsieh, Tsung-Han Tsai, Chin-Han Lin, Shih-Chieh Chang, Ting-Yu Chao, Meng-En Wang, Hsei-Wei Wong, Tai-Tong |
author_sort | Ho, Donald Ming-Tak |
collection | PubMed |
description | BACKGROUND: Pediatric embryonal brain tumors (PEBTs), which encompass medulloblastoma (MB), primitive neuroectodermal tumor (PNET) and atypical teratoid/rhabdoid tumor (AT/RT), are the second most prevalent pediatric brain tumor type. AT/RT is highly malignant and is often misdiagnosed as MB or PNET. The distinction of AT/RT from PNET/MB is of clinical significance because the survival rate of patients with AT/RT is substantially lower. The diagnosis of AT/RT relies primarily on morphologic assessment and immunohistochemical (IHC) staining for a few known markers such as the lack of INI1 protein expression. However, in our clinical practice we have observed several AT/RT-like tumors, that fulfilled histopathological and all other biomarker criteria for a diagnosis of AT/RT, yet retained INI1 immunoreactivity. Recent studies have also reported preserved INI1 immunoreactivity among certain diagnosed AT/RTs. It is therefore necessary to re-evaluate INI1(+), AT/RT-like cases. METHOD: Sanger sequencing, array CGH and mRNA microarray analyses were performed on PEBT samples to investigate their genomic landscapes. RESULTS: Patients with AT/RT and those with INI(+) AT/RT-like tumors showed a similar survival rate, and global array CGH analysis and INI1 gene sequencing showed no differential chromosomal aberration markers between INI1(−) AT/RT and INI(+) AT/RT-like cases. We did not misdiagnose MBs or PNETs as AT/RT-like tumors because transcriptome profiling revealed that not only did AT/RT and INI(+) AT/RT-like cases express distinct mRNA and microRNA profiles, their gene expression patterns were different from those of MBs and PNETs. The most similar transcriptome profile to that of AT/RTs was the profile of embryonic stem cells. However; the transcriptome profile of INI1(+) AT/RT-like tumors was more similar to that of somatic neural stem cells, while the profile of MBs was closer to that of fetal brain tissue. Novel biomarkers were identified that can be used to distinguish INI1(−) AT/RTs, INI1(+) AT/RT-like cases and MBs. CONCLUSION: Our studies revealed a novel INI1(+) ATRT-like subtype among Taiwanese pediatric patients. New diagnostic biomarkers, as well as new therapeutic tactics, can be developed according to the transcriptome data that were unveiled in this work. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s12920-015-0103-3) contains supplementary material, which is available to authorized users. |
format | Online Article Text |
id | pubmed-4480900 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2015 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-44809002015-06-26 Integrated genomics has identified a new AT/RT-like yet INI1-positive brain tumor subtype among primary pediatric embryonal tumors Ho, Donald Ming-Tak Shih, Chuan-Chi Liang, Muh-Lii Tsai, Chan-Yen Hsieh, Tsung-Han Tsai, Chin-Han Lin, Shih-Chieh Chang, Ting-Yu Chao, Meng-En Wang, Hsei-Wei Wong, Tai-Tong BMC Med Genomics Research Article BACKGROUND: Pediatric embryonal brain tumors (PEBTs), which encompass medulloblastoma (MB), primitive neuroectodermal tumor (PNET) and atypical teratoid/rhabdoid tumor (AT/RT), are the second most prevalent pediatric brain tumor type. AT/RT is highly malignant and is often misdiagnosed as MB or PNET. The distinction of AT/RT from PNET/MB is of clinical significance because the survival rate of patients with AT/RT is substantially lower. The diagnosis of AT/RT relies primarily on morphologic assessment and immunohistochemical (IHC) staining for a few known markers such as the lack of INI1 protein expression. However, in our clinical practice we have observed several AT/RT-like tumors, that fulfilled histopathological and all other biomarker criteria for a diagnosis of AT/RT, yet retained INI1 immunoreactivity. Recent studies have also reported preserved INI1 immunoreactivity among certain diagnosed AT/RTs. It is therefore necessary to re-evaluate INI1(+), AT/RT-like cases. METHOD: Sanger sequencing, array CGH and mRNA microarray analyses were performed on PEBT samples to investigate their genomic landscapes. RESULTS: Patients with AT/RT and those with INI(+) AT/RT-like tumors showed a similar survival rate, and global array CGH analysis and INI1 gene sequencing showed no differential chromosomal aberration markers between INI1(−) AT/RT and INI(+) AT/RT-like cases. We did not misdiagnose MBs or PNETs as AT/RT-like tumors because transcriptome profiling revealed that not only did AT/RT and INI(+) AT/RT-like cases express distinct mRNA and microRNA profiles, their gene expression patterns were different from those of MBs and PNETs. The most similar transcriptome profile to that of AT/RTs was the profile of embryonic stem cells. However; the transcriptome profile of INI1(+) AT/RT-like tumors was more similar to that of somatic neural stem cells, while the profile of MBs was closer to that of fetal brain tissue. Novel biomarkers were identified that can be used to distinguish INI1(−) AT/RTs, INI1(+) AT/RT-like cases and MBs. CONCLUSION: Our studies revealed a novel INI1(+) ATRT-like subtype among Taiwanese pediatric patients. New diagnostic biomarkers, as well as new therapeutic tactics, can be developed according to the transcriptome data that were unveiled in this work. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s12920-015-0103-3) contains supplementary material, which is available to authorized users. BioMed Central 2015-06-25 /pmc/articles/PMC4480900/ /pubmed/26109171 http://dx.doi.org/10.1186/s12920-015-0103-3 Text en © Ho et al. 2015 This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly credited. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Research Article Ho, Donald Ming-Tak Shih, Chuan-Chi Liang, Muh-Lii Tsai, Chan-Yen Hsieh, Tsung-Han Tsai, Chin-Han Lin, Shih-Chieh Chang, Ting-Yu Chao, Meng-En Wang, Hsei-Wei Wong, Tai-Tong Integrated genomics has identified a new AT/RT-like yet INI1-positive brain tumor subtype among primary pediatric embryonal tumors |
title | Integrated genomics has identified a new AT/RT-like yet INI1-positive brain tumor subtype among primary pediatric embryonal tumors |
title_full | Integrated genomics has identified a new AT/RT-like yet INI1-positive brain tumor subtype among primary pediatric embryonal tumors |
title_fullStr | Integrated genomics has identified a new AT/RT-like yet INI1-positive brain tumor subtype among primary pediatric embryonal tumors |
title_full_unstemmed | Integrated genomics has identified a new AT/RT-like yet INI1-positive brain tumor subtype among primary pediatric embryonal tumors |
title_short | Integrated genomics has identified a new AT/RT-like yet INI1-positive brain tumor subtype among primary pediatric embryonal tumors |
title_sort | integrated genomics has identified a new at/rt-like yet ini1-positive brain tumor subtype among primary pediatric embryonal tumors |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4480900/ https://www.ncbi.nlm.nih.gov/pubmed/26109171 http://dx.doi.org/10.1186/s12920-015-0103-3 |
work_keys_str_mv | AT hodonaldmingtak integratedgenomicshasidentifiedanewatrtlikeyetini1positivebraintumorsubtypeamongprimarypediatricembryonaltumors AT shihchuanchi integratedgenomicshasidentifiedanewatrtlikeyetini1positivebraintumorsubtypeamongprimarypediatricembryonaltumors AT liangmuhlii integratedgenomicshasidentifiedanewatrtlikeyetini1positivebraintumorsubtypeamongprimarypediatricembryonaltumors AT tsaichanyen integratedgenomicshasidentifiedanewatrtlikeyetini1positivebraintumorsubtypeamongprimarypediatricembryonaltumors AT hsiehtsunghan integratedgenomicshasidentifiedanewatrtlikeyetini1positivebraintumorsubtypeamongprimarypediatricembryonaltumors AT tsaichinhan integratedgenomicshasidentifiedanewatrtlikeyetini1positivebraintumorsubtypeamongprimarypediatricembryonaltumors AT linshihchieh integratedgenomicshasidentifiedanewatrtlikeyetini1positivebraintumorsubtypeamongprimarypediatricembryonaltumors AT changtingyu integratedgenomicshasidentifiedanewatrtlikeyetini1positivebraintumorsubtypeamongprimarypediatricembryonaltumors AT chaomengen integratedgenomicshasidentifiedanewatrtlikeyetini1positivebraintumorsubtypeamongprimarypediatricembryonaltumors AT wanghseiwei integratedgenomicshasidentifiedanewatrtlikeyetini1positivebraintumorsubtypeamongprimarypediatricembryonaltumors AT wongtaitong integratedgenomicshasidentifiedanewatrtlikeyetini1positivebraintumorsubtypeamongprimarypediatricembryonaltumors |