Deposition characteristics of a new allergic rhinitis nasal spray (MP29-02*) in an anatomical model of the human nasal cavity

Detalles Bibliográficos
Autores principales: D’Addio, Alex, Ruiz, Nancy, Mayer, Michael, Murray, Ruth, Bachert, Claus
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2015
Materias:
Poster Presentation
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4493600/
http://dx.doi.org/10.1186/2045-7022-5-S4-P40
_version_ 1782379946809753600
author D’Addio, Alex
Ruiz, Nancy
Mayer, Michael
Murray, Ruth
Bachert, Claus
author_facet D’Addio, Alex
Ruiz, Nancy
Mayer, Michael
Murray, Ruth
Bachert, Claus
author_sort D’Addio, Alex
collection PubMed
description
format Online
Article
Text
id pubmed-4493600
institution National Center for Biotechnology Information
language English
publishDate 2015
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-44936002015-07-15 Deposition characteristics of a new allergic rhinitis nasal spray (MP29-02*) in an anatomical model of the human nasal cavity D’Addio, Alex Ruiz, Nancy Mayer, Michael Murray, Ruth Bachert, Claus Clin Transl Allergy Poster Presentation BioMed Central 2015-06-26 /pmc/articles/PMC4493600/ http://dx.doi.org/10.1186/2045-7022-5-S4-P40 Text en Copyright © 2015 D’Addio et al. http://creativecommons.org/licenses/by/4.0 This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Poster Presentation
D’Addio, Alex
Ruiz, Nancy
Mayer, Michael
Murray, Ruth
Bachert, Claus
Deposition characteristics of a new allergic rhinitis nasal spray (MP29-02*) in an anatomical model of the human nasal cavity
title Deposition characteristics of a new allergic rhinitis nasal spray (MP29-02*) in an anatomical model of the human nasal cavity
title_full Deposition characteristics of a new allergic rhinitis nasal spray (MP29-02*) in an anatomical model of the human nasal cavity
title_fullStr Deposition characteristics of a new allergic rhinitis nasal spray (MP29-02*) in an anatomical model of the human nasal cavity
title_full_unstemmed Deposition characteristics of a new allergic rhinitis nasal spray (MP29-02*) in an anatomical model of the human nasal cavity
title_short Deposition characteristics of a new allergic rhinitis nasal spray (MP29-02*) in an anatomical model of the human nasal cavity
title_sort deposition characteristics of a new allergic rhinitis nasal spray (mp29-02*) in an anatomical model of the human nasal cavity
topic Poster Presentation
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4493600/
http://dx.doi.org/10.1186/2045-7022-5-S4-P40
work_keys_str_mv AT daddioalex depositioncharacteristicsofanewallergicrhinitisnasalspraymp2902inananatomicalmodelofthehumannasalcavity
AT ruiznancy depositioncharacteristicsofanewallergicrhinitisnasalspraymp2902inananatomicalmodelofthehumannasalcavity
AT mayermichael depositioncharacteristicsofanewallergicrhinitisnasalspraymp2902inananatomicalmodelofthehumannasalcavity
AT murrayruth depositioncharacteristicsofanewallergicrhinitisnasalspraymp2902inananatomicalmodelofthehumannasalcavity
AT bachertclaus depositioncharacteristicsofanewallergicrhinitisnasalspraymp2902inananatomicalmodelofthehumannasalcavity

Ejemplares similares