Cargando…

Effect of Qing’e formula on the in vitro differentiation of bone marrow-derived mesenchymal stem cells from proximal femurs of postmenopausal osteoporotic mice

BACKGROUND: Qing’e formula (QEF), prepared from an ancient Chinese recipe, was previously suggested to regulate bone metabolism and improve bone mineral density in patients with osteoporosis. To study the effects of medicated serum containing QEF on the in vitro differentiation of bone marrow-derive...

Descripción completa

Detalles Bibliográficos
Autores principales: Shuai, Bo, Shen, Lin, Zhu, Rui, Zhou, Piqi
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2015
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4513391/
https://www.ncbi.nlm.nih.gov/pubmed/26205885
http://dx.doi.org/10.1186/s12906-015-0777-2
_version_ 1782382638694137856
author Shuai, Bo
Shen, Lin
Zhu, Rui
Zhou, Piqi
author_facet Shuai, Bo
Shen, Lin
Zhu, Rui
Zhou, Piqi
author_sort Shuai, Bo
collection PubMed
description BACKGROUND: Qing’e formula (QEF), prepared from an ancient Chinese recipe, was previously suggested to regulate bone metabolism and improve bone mineral density in patients with osteoporosis. To study the effects of medicated serum containing QEF on the in vitro differentiation of bone marrow-derived mesenchymal stem cells (BMSCs) isolated from the proximal femurs of postmenopausal osteoporosis (PMOP) mice. METHODS: Using an established mouse model of PMOP, mononuclear cells were isolated from the bone marrow present in the proximal femurs and cultured. PMOP mice were also randomly divided into four groups: the untreated group (Group A) and the groups treated with respectively low (Group B), medium (Group C), and high (Group D) concentrations of QEF. Serum was isolated from each and used to treat the cultured BMSCs in conjunction with recombinant human bone morphogenetic protein-2 (rhBMP-2). Cell morphology, proliferation rates, intracellular alkaline phosphatase (ALP) activity, and transforming growth factor-beta 1 (TGF-β1) mRNA expression were evaluated. RESULTS: QEF-treated serum, particularly that containing moderate and high concentrations, appears to enhance the rhBMP-2-mediated changes in cell morphology, proliferation, and differentiation (determined via the expression of TGF-β1 mRNA and ALP activity) observed in the BMSCs isolated from PMOP mice. CONCLUSIONS: QEF may play a role in the prevention and treatment of PMOP by enhancing the activity of rhBMP-2.
format Online
Article
Text
id pubmed-4513391
institution National Center for Biotechnology Information
language English
publishDate 2015
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-45133912015-07-25 Effect of Qing’e formula on the in vitro differentiation of bone marrow-derived mesenchymal stem cells from proximal femurs of postmenopausal osteoporotic mice Shuai, Bo Shen, Lin Zhu, Rui Zhou, Piqi BMC Complement Altern Med Research Article BACKGROUND: Qing’e formula (QEF), prepared from an ancient Chinese recipe, was previously suggested to regulate bone metabolism and improve bone mineral density in patients with osteoporosis. To study the effects of medicated serum containing QEF on the in vitro differentiation of bone marrow-derived mesenchymal stem cells (BMSCs) isolated from the proximal femurs of postmenopausal osteoporosis (PMOP) mice. METHODS: Using an established mouse model of PMOP, mononuclear cells were isolated from the bone marrow present in the proximal femurs and cultured. PMOP mice were also randomly divided into four groups: the untreated group (Group A) and the groups treated with respectively low (Group B), medium (Group C), and high (Group D) concentrations of QEF. Serum was isolated from each and used to treat the cultured BMSCs in conjunction with recombinant human bone morphogenetic protein-2 (rhBMP-2). Cell morphology, proliferation rates, intracellular alkaline phosphatase (ALP) activity, and transforming growth factor-beta 1 (TGF-β1) mRNA expression were evaluated. RESULTS: QEF-treated serum, particularly that containing moderate and high concentrations, appears to enhance the rhBMP-2-mediated changes in cell morphology, proliferation, and differentiation (determined via the expression of TGF-β1 mRNA and ALP activity) observed in the BMSCs isolated from PMOP mice. CONCLUSIONS: QEF may play a role in the prevention and treatment of PMOP by enhancing the activity of rhBMP-2. BioMed Central 2015-07-24 /pmc/articles/PMC4513391/ /pubmed/26205885 http://dx.doi.org/10.1186/s12906-015-0777-2 Text en © Shuai et al. 2015 This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly credited. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research Article
Shuai, Bo
Shen, Lin
Zhu, Rui
Zhou, Piqi
Effect of Qing’e formula on the in vitro differentiation of bone marrow-derived mesenchymal stem cells from proximal femurs of postmenopausal osteoporotic mice
title Effect of Qing’e formula on the in vitro differentiation of bone marrow-derived mesenchymal stem cells from proximal femurs of postmenopausal osteoporotic mice
title_full Effect of Qing’e formula on the in vitro differentiation of bone marrow-derived mesenchymal stem cells from proximal femurs of postmenopausal osteoporotic mice
title_fullStr Effect of Qing’e formula on the in vitro differentiation of bone marrow-derived mesenchymal stem cells from proximal femurs of postmenopausal osteoporotic mice
title_full_unstemmed Effect of Qing’e formula on the in vitro differentiation of bone marrow-derived mesenchymal stem cells from proximal femurs of postmenopausal osteoporotic mice
title_short Effect of Qing’e formula on the in vitro differentiation of bone marrow-derived mesenchymal stem cells from proximal femurs of postmenopausal osteoporotic mice
title_sort effect of qing’e formula on the in vitro differentiation of bone marrow-derived mesenchymal stem cells from proximal femurs of postmenopausal osteoporotic mice
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4513391/
https://www.ncbi.nlm.nih.gov/pubmed/26205885
http://dx.doi.org/10.1186/s12906-015-0777-2
work_keys_str_mv AT shuaibo effectofqingeformulaontheinvitrodifferentiationofbonemarrowderivedmesenchymalstemcellsfromproximalfemursofpostmenopausalosteoporoticmice
AT shenlin effectofqingeformulaontheinvitrodifferentiationofbonemarrowderivedmesenchymalstemcellsfromproximalfemursofpostmenopausalosteoporoticmice
AT zhurui effectofqingeformulaontheinvitrodifferentiationofbonemarrowderivedmesenchymalstemcellsfromproximalfemursofpostmenopausalosteoporoticmice
AT zhoupiqi effectofqingeformulaontheinvitrodifferentiationofbonemarrowderivedmesenchymalstemcellsfromproximalfemursofpostmenopausalosteoporoticmice