Cargando…
Identification of Caspase Cleavage Sites in KSHV Latency-Associated Nuclear Antigen and Their Effects on Caspase-Related Host Defense Responses
Kaposi’s sarcoma-associated herpesvirus (KSHV), also known as human herpesvirus-8, is the causative agent of three hyperproliferative disorders: Kaposi’s sarcoma, primary effusion lymphoma (PEL) and multicentric Castleman’s disease. During viral latency a small subset of viral genes are produced, in...
Autores principales: | , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Public Library of Science
2015
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4517896/ https://www.ncbi.nlm.nih.gov/pubmed/26218605 http://dx.doi.org/10.1371/journal.ppat.1005064 |
_version_ | 1782383258752778240 |
---|---|
author | Davis, David A. Naiman, Nicole E. Wang, Victoria Shrestha, Prabha Haque, Muzammel Hu, Duosha Anagho, Holda A. Carey, Robert F. Davidoff, Katharine S. Yarchoan, Robert |
author_facet | Davis, David A. Naiman, Nicole E. Wang, Victoria Shrestha, Prabha Haque, Muzammel Hu, Duosha Anagho, Holda A. Carey, Robert F. Davidoff, Katharine S. Yarchoan, Robert |
author_sort | Davis, David A. |
collection | PubMed |
description | Kaposi’s sarcoma-associated herpesvirus (KSHV), also known as human herpesvirus-8, is the causative agent of three hyperproliferative disorders: Kaposi’s sarcoma, primary effusion lymphoma (PEL) and multicentric Castleman’s disease. During viral latency a small subset of viral genes are produced, including KSHV latency-associated nuclear antigen (LANA), which help the virus thwart cellular defense responses. We found that exposure of KSHV-infected cells to oxidative stress, or other inducers of apoptosis and caspase activation, led to processing of LANA and that this processing could be inhibited with the pan-caspase inhibitor Z-VAD-FMK. Using sequence, peptide, and mutational analysis, two caspase cleavage sites within LANA were identified: a site for caspase-3 type caspases at the N-terminus and a site for caspase-1 and-3 type caspases at the C-terminus. Using LANA expression plasmids, we demonstrated that mutation of these cleavage sites prevents caspase-1 and caspase-3 processing of LANA. This indicates that these are the principal sites that are susceptible to caspase cleavage. Using peptides spanning the identified LANA cleavage sites, we show that caspase activity can be inhibited in vitro and that a cell-permeable peptide spanning the C-terminal cleavage site could inhibit cleavage of poly (ADP-ribose) polymerase and increase viability in cells undergoing etoposide-induced apoptosis. The C-terminal peptide of LANA also inhibited interleukin-1beta (IL-1β) production from lipopolysaccharide-treated THP-1 cells by more than 50%. Furthermore, mutation of the two cleavage sites in LANA led to a significant increase in IL-1β production in transfected THP-1 cells; this provides evidence that these sites function to blunt the inflammasome, which is known to be activated in latently infected PEL cells. These results suggest that specific caspase cleavage sites in KSHV LANA function to blunt apoptosis as well as interfere with the caspase-1-mediated inflammasome, thus thwarting key cellular defense mechanisms. |
format | Online Article Text |
id | pubmed-4517896 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2015 |
publisher | Public Library of Science |
record_format | MEDLINE/PubMed |
spelling | pubmed-45178962015-07-31 Identification of Caspase Cleavage Sites in KSHV Latency-Associated Nuclear Antigen and Their Effects on Caspase-Related Host Defense Responses Davis, David A. Naiman, Nicole E. Wang, Victoria Shrestha, Prabha Haque, Muzammel Hu, Duosha Anagho, Holda A. Carey, Robert F. Davidoff, Katharine S. Yarchoan, Robert PLoS Pathog Research Article Kaposi’s sarcoma-associated herpesvirus (KSHV), also known as human herpesvirus-8, is the causative agent of three hyperproliferative disorders: Kaposi’s sarcoma, primary effusion lymphoma (PEL) and multicentric Castleman’s disease. During viral latency a small subset of viral genes are produced, including KSHV latency-associated nuclear antigen (LANA), which help the virus thwart cellular defense responses. We found that exposure of KSHV-infected cells to oxidative stress, or other inducers of apoptosis and caspase activation, led to processing of LANA and that this processing could be inhibited with the pan-caspase inhibitor Z-VAD-FMK. Using sequence, peptide, and mutational analysis, two caspase cleavage sites within LANA were identified: a site for caspase-3 type caspases at the N-terminus and a site for caspase-1 and-3 type caspases at the C-terminus. Using LANA expression plasmids, we demonstrated that mutation of these cleavage sites prevents caspase-1 and caspase-3 processing of LANA. This indicates that these are the principal sites that are susceptible to caspase cleavage. Using peptides spanning the identified LANA cleavage sites, we show that caspase activity can be inhibited in vitro and that a cell-permeable peptide spanning the C-terminal cleavage site could inhibit cleavage of poly (ADP-ribose) polymerase and increase viability in cells undergoing etoposide-induced apoptosis. The C-terminal peptide of LANA also inhibited interleukin-1beta (IL-1β) production from lipopolysaccharide-treated THP-1 cells by more than 50%. Furthermore, mutation of the two cleavage sites in LANA led to a significant increase in IL-1β production in transfected THP-1 cells; this provides evidence that these sites function to blunt the inflammasome, which is known to be activated in latently infected PEL cells. These results suggest that specific caspase cleavage sites in KSHV LANA function to blunt apoptosis as well as interfere with the caspase-1-mediated inflammasome, thus thwarting key cellular defense mechanisms. Public Library of Science 2015-07-28 /pmc/articles/PMC4517896/ /pubmed/26218605 http://dx.doi.org/10.1371/journal.ppat.1005064 Text en https://creativecommons.org/publicdomain/zero/1.0/ This is an open-access article distributed under the terms of the Creative Commons Public Domain declaration, which stipulates that, once placed in the public domain, this work may be freely reproduced, distributed, transmitted, modified, built upon, or otherwise used by anyone for any lawful purpose. |
spellingShingle | Research Article Davis, David A. Naiman, Nicole E. Wang, Victoria Shrestha, Prabha Haque, Muzammel Hu, Duosha Anagho, Holda A. Carey, Robert F. Davidoff, Katharine S. Yarchoan, Robert Identification of Caspase Cleavage Sites in KSHV Latency-Associated Nuclear Antigen and Their Effects on Caspase-Related Host Defense Responses |
title | Identification of Caspase Cleavage Sites in KSHV Latency-Associated Nuclear Antigen and Their Effects on Caspase-Related Host Defense Responses |
title_full | Identification of Caspase Cleavage Sites in KSHV Latency-Associated Nuclear Antigen and Their Effects on Caspase-Related Host Defense Responses |
title_fullStr | Identification of Caspase Cleavage Sites in KSHV Latency-Associated Nuclear Antigen and Their Effects on Caspase-Related Host Defense Responses |
title_full_unstemmed | Identification of Caspase Cleavage Sites in KSHV Latency-Associated Nuclear Antigen and Their Effects on Caspase-Related Host Defense Responses |
title_short | Identification of Caspase Cleavage Sites in KSHV Latency-Associated Nuclear Antigen and Their Effects on Caspase-Related Host Defense Responses |
title_sort | identification of caspase cleavage sites in kshv latency-associated nuclear antigen and their effects on caspase-related host defense responses |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4517896/ https://www.ncbi.nlm.nih.gov/pubmed/26218605 http://dx.doi.org/10.1371/journal.ppat.1005064 |
work_keys_str_mv | AT davisdavida identificationofcaspasecleavagesitesinkshvlatencyassociatednuclearantigenandtheireffectsoncaspaserelatedhostdefenseresponses AT naimannicolee identificationofcaspasecleavagesitesinkshvlatencyassociatednuclearantigenandtheireffectsoncaspaserelatedhostdefenseresponses AT wangvictoria identificationofcaspasecleavagesitesinkshvlatencyassociatednuclearantigenandtheireffectsoncaspaserelatedhostdefenseresponses AT shresthaprabha identificationofcaspasecleavagesitesinkshvlatencyassociatednuclearantigenandtheireffectsoncaspaserelatedhostdefenseresponses AT haquemuzammel identificationofcaspasecleavagesitesinkshvlatencyassociatednuclearantigenandtheireffectsoncaspaserelatedhostdefenseresponses AT huduosha identificationofcaspasecleavagesitesinkshvlatencyassociatednuclearantigenandtheireffectsoncaspaserelatedhostdefenseresponses AT anaghoholdaa identificationofcaspasecleavagesitesinkshvlatencyassociatednuclearantigenandtheireffectsoncaspaserelatedhostdefenseresponses AT careyrobertf identificationofcaspasecleavagesitesinkshvlatencyassociatednuclearantigenandtheireffectsoncaspaserelatedhostdefenseresponses AT davidoffkatharines identificationofcaspasecleavagesitesinkshvlatencyassociatednuclearantigenandtheireffectsoncaspaserelatedhostdefenseresponses AT yarchoanrobert identificationofcaspasecleavagesitesinkshvlatencyassociatednuclearantigenandtheireffectsoncaspaserelatedhostdefenseresponses |