Cargando…

Relationship between Peripapillary Retinal Nerve Fiber Layer Thickness Measured by Optical Coherence Tomography and Visual Field Severity Indices

PURPOSE: Though there are many reports regarding the structure-function relationship in glaucoma, they are too complicated to apply to the routine clinical setting. The aim of this study was to investigate the direct relationship between peripapillary retinal nerve fiber layer (RNFL) thickness measu...

Descripción completa

Detalles Bibliográficos
Autores principales: Kang, Eun Min, Hong, Samin, Kim, Chan Yun, Seong, Gong Je
Formato: Online Artículo Texto
Lenguaje:English
Publicado: The Korean Ophthalmological Society 2015
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4520870/
https://www.ncbi.nlm.nih.gov/pubmed/26240511
http://dx.doi.org/10.3341/kjo.2015.29.4.263
_version_ 1782383723653627904
author Kang, Eun Min
Hong, Samin
Kim, Chan Yun
Seong, Gong Je
author_facet Kang, Eun Min
Hong, Samin
Kim, Chan Yun
Seong, Gong Je
author_sort Kang, Eun Min
collection PubMed
description PURPOSE: Though there are many reports regarding the structure-function relationship in glaucoma, they are too complicated to apply to the routine clinical setting. The aim of this study was to investigate the direct relationship between peripapillary retinal nerve fiber layer (RNFL) thickness measured by optical coherence tomography (OCT) and visual field (VF) severity indices computed by standard automated perimetry. METHODS: This cross-sectional comparative study included 104 glaucomatous patients and 59 healthy subjects. Peripapillary RNFL thickness was measured by spectral domain (SD) and time domain (TD) OCTs. Four glaucoma VF severity indices, including mean deviation (MD), pattern standard deviation (PSD), Collaborative Initial Glaucoma Treatment Study (CIGTS) VF score, and Advanced Glaucoma Intervention Study (AGIS) VF score, were calculated using standard automated perimetry. The Pearson's correlation coefficients (r) between the average and quadrants of peripapillary RNFL thicknesses and the four VF severity indices were calculated. RESULTS: In glaucomatous eyes, the r value between the average RNFL thickness measured by SD OCT and each VF severity index were 0.562, -0.514, -0.577, and -0.567 for the MD, PSD, CIGTS VF score, and AGIS VF score, respectively (all p < 0.001). Among each quadrant, the inferior RNFL thickness showed the largest r value; 0.587, -0.552, -0.613, and -0.598 for the MD, PSD, CIGTS VF score, and AGIS VF score, respectively (all p < 0.001). Measurements by TD OCT showed similar strengths of association with SD OCT. CONCLUSIONS: Moderate correlation was identified between peripapillary RNFL thicknesses measured by SD/TD OCT and glaucoma VF severity indices. Among each quadrant, the inferior RNFL thickness showed the greatest association with glaucoma VF severity indices. There was no significant difference according to the type of VF severity index or the type of OCTs.
format Online
Article
Text
id pubmed-4520870
institution National Center for Biotechnology Information
language English
publishDate 2015
publisher The Korean Ophthalmological Society
record_format MEDLINE/PubMed
spelling pubmed-45208702015-08-03 Relationship between Peripapillary Retinal Nerve Fiber Layer Thickness Measured by Optical Coherence Tomography and Visual Field Severity Indices Kang, Eun Min Hong, Samin Kim, Chan Yun Seong, Gong Je Korean J Ophthalmol Original Article PURPOSE: Though there are many reports regarding the structure-function relationship in glaucoma, they are too complicated to apply to the routine clinical setting. The aim of this study was to investigate the direct relationship between peripapillary retinal nerve fiber layer (RNFL) thickness measured by optical coherence tomography (OCT) and visual field (VF) severity indices computed by standard automated perimetry. METHODS: This cross-sectional comparative study included 104 glaucomatous patients and 59 healthy subjects. Peripapillary RNFL thickness was measured by spectral domain (SD) and time domain (TD) OCTs. Four glaucoma VF severity indices, including mean deviation (MD), pattern standard deviation (PSD), Collaborative Initial Glaucoma Treatment Study (CIGTS) VF score, and Advanced Glaucoma Intervention Study (AGIS) VF score, were calculated using standard automated perimetry. The Pearson's correlation coefficients (r) between the average and quadrants of peripapillary RNFL thicknesses and the four VF severity indices were calculated. RESULTS: In glaucomatous eyes, the r value between the average RNFL thickness measured by SD OCT and each VF severity index were 0.562, -0.514, -0.577, and -0.567 for the MD, PSD, CIGTS VF score, and AGIS VF score, respectively (all p < 0.001). Among each quadrant, the inferior RNFL thickness showed the largest r value; 0.587, -0.552, -0.613, and -0.598 for the MD, PSD, CIGTS VF score, and AGIS VF score, respectively (all p < 0.001). Measurements by TD OCT showed similar strengths of association with SD OCT. CONCLUSIONS: Moderate correlation was identified between peripapillary RNFL thicknesses measured by SD/TD OCT and glaucoma VF severity indices. Among each quadrant, the inferior RNFL thickness showed the greatest association with glaucoma VF severity indices. There was no significant difference according to the type of VF severity index or the type of OCTs. The Korean Ophthalmological Society 2015-08 2015-07-21 /pmc/articles/PMC4520870/ /pubmed/26240511 http://dx.doi.org/10.3341/kjo.2015.29.4.263 Text en © 2015 The Korean Ophthalmological Society http://creativecommons.org/licenses/by-nc/3.0/ This is an Open Access article distributed under the terms of the Creative Commons Attribution Non-Commercial License (http://creativecommons.org/licenses/by-nc/3.0/) which permits unrestricted non-commercial use, distribution, and reproduction in any medium, provided the original work is properly cited.
spellingShingle Original Article
Kang, Eun Min
Hong, Samin
Kim, Chan Yun
Seong, Gong Je
Relationship between Peripapillary Retinal Nerve Fiber Layer Thickness Measured by Optical Coherence Tomography and Visual Field Severity Indices
title Relationship between Peripapillary Retinal Nerve Fiber Layer Thickness Measured by Optical Coherence Tomography and Visual Field Severity Indices
title_full Relationship between Peripapillary Retinal Nerve Fiber Layer Thickness Measured by Optical Coherence Tomography and Visual Field Severity Indices
title_fullStr Relationship between Peripapillary Retinal Nerve Fiber Layer Thickness Measured by Optical Coherence Tomography and Visual Field Severity Indices
title_full_unstemmed Relationship between Peripapillary Retinal Nerve Fiber Layer Thickness Measured by Optical Coherence Tomography and Visual Field Severity Indices
title_short Relationship between Peripapillary Retinal Nerve Fiber Layer Thickness Measured by Optical Coherence Tomography and Visual Field Severity Indices
title_sort relationship between peripapillary retinal nerve fiber layer thickness measured by optical coherence tomography and visual field severity indices
topic Original Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4520870/
https://www.ncbi.nlm.nih.gov/pubmed/26240511
http://dx.doi.org/10.3341/kjo.2015.29.4.263
work_keys_str_mv AT kangeunmin relationshipbetweenperipapillaryretinalnervefiberlayerthicknessmeasuredbyopticalcoherencetomographyandvisualfieldseverityindices
AT hongsamin relationshipbetweenperipapillaryretinalnervefiberlayerthicknessmeasuredbyopticalcoherencetomographyandvisualfieldseverityindices
AT kimchanyun relationshipbetweenperipapillaryretinalnervefiberlayerthicknessmeasuredbyopticalcoherencetomographyandvisualfieldseverityindices
AT seonggongje relationshipbetweenperipapillaryretinalnervefiberlayerthicknessmeasuredbyopticalcoherencetomographyandvisualfieldseverityindices