Cargando…

The role of epigenetics in kidney malignancies

INTRODUCTION: Renal cell carcinomas (RCC) are collectively the third most common type of genitourinary neoplasms, surpassed only by prostate and bladder cancer. Cure rates for renal cell carcinoma are related to tumor grade and stage; therefore, diagnostic methods for early detection and new therape...

Descripción completa

Detalles Bibliográficos
Autores principales: la Rosa, Alfredo Harb-De, Acker, Matthew, Swain, Sanjaya, Manoharan, Murugesan
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Polish Urological Association 2015
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4526599/
https://www.ncbi.nlm.nih.gov/pubmed/26251734
http://dx.doi.org/10.5173/ceju.2015.453
_version_ 1782384436235468800
author la Rosa, Alfredo Harb-De
Acker, Matthew
Swain, Sanjaya
Manoharan, Murugesan
author_facet la Rosa, Alfredo Harb-De
Acker, Matthew
Swain, Sanjaya
Manoharan, Murugesan
author_sort la Rosa, Alfredo Harb-De
collection PubMed
description INTRODUCTION: Renal cell carcinomas (RCC) are collectively the third most common type of genitourinary neoplasms, surpassed only by prostate and bladder cancer. Cure rates for renal cell carcinoma are related to tumor grade and stage; therefore, diagnostic methods for early detection and new therapeutic modalities are of paramount importance. Epigenetics can be defined as inherited modifications in gene expression that are not encoded in the DNA sequence itself. Epigenetics may play an important role in the pursuit of early diagnosis, accurate prognostication and identification of new therapeutic targets. MATERIAL AND METHODS: We used PubMed to conduct a comprehensive search of the English medical literature using search terms including epigenetics, DNA methylation, histone modification, microRNA regulation (miRNA) and RCC. In this review, we discuss the potential application of epigenetics in the diagnosis, prognosis and treatment of kidney cancer. RESULTS: During the last decade, many different types of epigenetic alterations of DNA have been found to be associated with malignant renal tumors. This has led to the research of the diagnostic and prognostic implications of these changes in renal malignancies as well as to the development of novel drugs to target these changes, with the aim of achieving a survival benefit. CONCLUSIONS: Epigenetics has become a promising field in cancer research. The potential to achieve early detection and accurate prognostication in kidney cancer might be feasible through the application of epigenetics. The possibility to reverse these epigenetic changes with new therapeutic agents motivates researchers to continue pursuing better treatment options for kidney cancer and other malignancies.
format Online
Article
Text
id pubmed-4526599
institution National Center for Biotechnology Information
language English
publishDate 2015
publisher Polish Urological Association
record_format MEDLINE/PubMed
spelling pubmed-45265992015-08-06 The role of epigenetics in kidney malignancies la Rosa, Alfredo Harb-De Acker, Matthew Swain, Sanjaya Manoharan, Murugesan Cent European J Urol Review Paper INTRODUCTION: Renal cell carcinomas (RCC) are collectively the third most common type of genitourinary neoplasms, surpassed only by prostate and bladder cancer. Cure rates for renal cell carcinoma are related to tumor grade and stage; therefore, diagnostic methods for early detection and new therapeutic modalities are of paramount importance. Epigenetics can be defined as inherited modifications in gene expression that are not encoded in the DNA sequence itself. Epigenetics may play an important role in the pursuit of early diagnosis, accurate prognostication and identification of new therapeutic targets. MATERIAL AND METHODS: We used PubMed to conduct a comprehensive search of the English medical literature using search terms including epigenetics, DNA methylation, histone modification, microRNA regulation (miRNA) and RCC. In this review, we discuss the potential application of epigenetics in the diagnosis, prognosis and treatment of kidney cancer. RESULTS: During the last decade, many different types of epigenetic alterations of DNA have been found to be associated with malignant renal tumors. This has led to the research of the diagnostic and prognostic implications of these changes in renal malignancies as well as to the development of novel drugs to target these changes, with the aim of achieving a survival benefit. CONCLUSIONS: Epigenetics has become a promising field in cancer research. The potential to achieve early detection and accurate prognostication in kidney cancer might be feasible through the application of epigenetics. The possibility to reverse these epigenetic changes with new therapeutic agents motivates researchers to continue pursuing better treatment options for kidney cancer and other malignancies. Polish Urological Association 2015-04-20 2015 /pmc/articles/PMC4526599/ /pubmed/26251734 http://dx.doi.org/10.5173/ceju.2015.453 Text en Copyright by Polish Urological Association http://creativecommons.org/licenses/by-nc-nd/3.0/ This is an Open Access article distributed under the terms of the Creative Commons Attribution-Noncommercial 3.0 Unported License, permitting all non-commercial use, distribution, and reproduction in any medium, provided the original work is properly cited.
spellingShingle Review Paper
la Rosa, Alfredo Harb-De
Acker, Matthew
Swain, Sanjaya
Manoharan, Murugesan
The role of epigenetics in kidney malignancies
title The role of epigenetics in kidney malignancies
title_full The role of epigenetics in kidney malignancies
title_fullStr The role of epigenetics in kidney malignancies
title_full_unstemmed The role of epigenetics in kidney malignancies
title_short The role of epigenetics in kidney malignancies
title_sort role of epigenetics in kidney malignancies
topic Review Paper
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4526599/
https://www.ncbi.nlm.nih.gov/pubmed/26251734
http://dx.doi.org/10.5173/ceju.2015.453
work_keys_str_mv AT larosaalfredoharbde theroleofepigeneticsinkidneymalignancies
AT ackermatthew theroleofepigeneticsinkidneymalignancies
AT swainsanjaya theroleofepigeneticsinkidneymalignancies
AT manoharanmurugesan theroleofepigeneticsinkidneymalignancies
AT larosaalfredoharbde roleofepigeneticsinkidneymalignancies
AT ackermatthew roleofepigeneticsinkidneymalignancies
AT swainsanjaya roleofepigeneticsinkidneymalignancies
AT manoharanmurugesan roleofepigeneticsinkidneymalignancies