Cargando…
The role of epigenetics in kidney malignancies
INTRODUCTION: Renal cell carcinomas (RCC) are collectively the third most common type of genitourinary neoplasms, surpassed only by prostate and bladder cancer. Cure rates for renal cell carcinoma are related to tumor grade and stage; therefore, diagnostic methods for early detection and new therape...
Autores principales: | , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Polish Urological Association
2015
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4526599/ https://www.ncbi.nlm.nih.gov/pubmed/26251734 http://dx.doi.org/10.5173/ceju.2015.453 |
_version_ | 1782384436235468800 |
---|---|
author | la Rosa, Alfredo Harb-De Acker, Matthew Swain, Sanjaya Manoharan, Murugesan |
author_facet | la Rosa, Alfredo Harb-De Acker, Matthew Swain, Sanjaya Manoharan, Murugesan |
author_sort | la Rosa, Alfredo Harb-De |
collection | PubMed |
description | INTRODUCTION: Renal cell carcinomas (RCC) are collectively the third most common type of genitourinary neoplasms, surpassed only by prostate and bladder cancer. Cure rates for renal cell carcinoma are related to tumor grade and stage; therefore, diagnostic methods for early detection and new therapeutic modalities are of paramount importance. Epigenetics can be defined as inherited modifications in gene expression that are not encoded in the DNA sequence itself. Epigenetics may play an important role in the pursuit of early diagnosis, accurate prognostication and identification of new therapeutic targets. MATERIAL AND METHODS: We used PubMed to conduct a comprehensive search of the English medical literature using search terms including epigenetics, DNA methylation, histone modification, microRNA regulation (miRNA) and RCC. In this review, we discuss the potential application of epigenetics in the diagnosis, prognosis and treatment of kidney cancer. RESULTS: During the last decade, many different types of epigenetic alterations of DNA have been found to be associated with malignant renal tumors. This has led to the research of the diagnostic and prognostic implications of these changes in renal malignancies as well as to the development of novel drugs to target these changes, with the aim of achieving a survival benefit. CONCLUSIONS: Epigenetics has become a promising field in cancer research. The potential to achieve early detection and accurate prognostication in kidney cancer might be feasible through the application of epigenetics. The possibility to reverse these epigenetic changes with new therapeutic agents motivates researchers to continue pursuing better treatment options for kidney cancer and other malignancies. |
format | Online Article Text |
id | pubmed-4526599 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2015 |
publisher | Polish Urological Association |
record_format | MEDLINE/PubMed |
spelling | pubmed-45265992015-08-06 The role of epigenetics in kidney malignancies la Rosa, Alfredo Harb-De Acker, Matthew Swain, Sanjaya Manoharan, Murugesan Cent European J Urol Review Paper INTRODUCTION: Renal cell carcinomas (RCC) are collectively the third most common type of genitourinary neoplasms, surpassed only by prostate and bladder cancer. Cure rates for renal cell carcinoma are related to tumor grade and stage; therefore, diagnostic methods for early detection and new therapeutic modalities are of paramount importance. Epigenetics can be defined as inherited modifications in gene expression that are not encoded in the DNA sequence itself. Epigenetics may play an important role in the pursuit of early diagnosis, accurate prognostication and identification of new therapeutic targets. MATERIAL AND METHODS: We used PubMed to conduct a comprehensive search of the English medical literature using search terms including epigenetics, DNA methylation, histone modification, microRNA regulation (miRNA) and RCC. In this review, we discuss the potential application of epigenetics in the diagnosis, prognosis and treatment of kidney cancer. RESULTS: During the last decade, many different types of epigenetic alterations of DNA have been found to be associated with malignant renal tumors. This has led to the research of the diagnostic and prognostic implications of these changes in renal malignancies as well as to the development of novel drugs to target these changes, with the aim of achieving a survival benefit. CONCLUSIONS: Epigenetics has become a promising field in cancer research. The potential to achieve early detection and accurate prognostication in kidney cancer might be feasible through the application of epigenetics. The possibility to reverse these epigenetic changes with new therapeutic agents motivates researchers to continue pursuing better treatment options for kidney cancer and other malignancies. Polish Urological Association 2015-04-20 2015 /pmc/articles/PMC4526599/ /pubmed/26251734 http://dx.doi.org/10.5173/ceju.2015.453 Text en Copyright by Polish Urological Association http://creativecommons.org/licenses/by-nc-nd/3.0/ This is an Open Access article distributed under the terms of the Creative Commons Attribution-Noncommercial 3.0 Unported License, permitting all non-commercial use, distribution, and reproduction in any medium, provided the original work is properly cited. |
spellingShingle | Review Paper la Rosa, Alfredo Harb-De Acker, Matthew Swain, Sanjaya Manoharan, Murugesan The role of epigenetics in kidney malignancies |
title | The role of epigenetics in kidney malignancies |
title_full | The role of epigenetics in kidney malignancies |
title_fullStr | The role of epigenetics in kidney malignancies |
title_full_unstemmed | The role of epigenetics in kidney malignancies |
title_short | The role of epigenetics in kidney malignancies |
title_sort | role of epigenetics in kidney malignancies |
topic | Review Paper |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4526599/ https://www.ncbi.nlm.nih.gov/pubmed/26251734 http://dx.doi.org/10.5173/ceju.2015.453 |
work_keys_str_mv | AT larosaalfredoharbde theroleofepigeneticsinkidneymalignancies AT ackermatthew theroleofepigeneticsinkidneymalignancies AT swainsanjaya theroleofepigeneticsinkidneymalignancies AT manoharanmurugesan theroleofepigeneticsinkidneymalignancies AT larosaalfredoharbde roleofepigeneticsinkidneymalignancies AT ackermatthew roleofepigeneticsinkidneymalignancies AT swainsanjaya roleofepigeneticsinkidneymalignancies AT manoharanmurugesan roleofepigeneticsinkidneymalignancies |