Cargando…

Development, inter-rater reliability and feasibility of a checklist to assess implementation (Ch-IMP) in systematic reviews: the case of provider-based prevention and treatment programs targeting children and youth

BACKGROUND: Several papers report deficiencies in the reporting of information about the implementation of interventions in clinical trials. Information about implementation is also required in systematic reviews of complex interventions to facilitate the translation and uptake of evidence of provid...

Descripción completa

Detalles Bibliográficos
Autores principales: Cargo, Margaret, Stankov, Ivana, Thomas, James, Saini, Michael, Rogers, Patricia, Mayo-Wilson, Evan, Hannes, Karin
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2015
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4562191/
https://www.ncbi.nlm.nih.gov/pubmed/26346461
http://dx.doi.org/10.1186/s12874-015-0037-7
_version_ 1782389133656719360
author Cargo, Margaret
Stankov, Ivana
Thomas, James
Saini, Michael
Rogers, Patricia
Mayo-Wilson, Evan
Hannes, Karin
author_facet Cargo, Margaret
Stankov, Ivana
Thomas, James
Saini, Michael
Rogers, Patricia
Mayo-Wilson, Evan
Hannes, Karin
author_sort Cargo, Margaret
collection PubMed
description BACKGROUND: Several papers report deficiencies in the reporting of information about the implementation of interventions in clinical trials. Information about implementation is also required in systematic reviews of complex interventions to facilitate the translation and uptake of evidence of provider-based prevention and treatment programs. To capture whether and how implementation is assessed within systematic effectiveness reviews, we developed a checklist for implementation (Ch-IMP) and piloted it in a cohort of reviews on provider-based prevention and treatment interventions for children and young people. This paper reports on the inter-rater reliability, feasibility and reasons for discrepant ratings. METHODS: Checklist domains were informed by a framework for program theory; items within domains were generated from a literature review. The checklist was pilot-tested on a cohort of 27 effectiveness reviews targeting children and youth. Two raters independently extracted information on 47 items. Inter-rater reliability was evaluated using percentage agreement and unweighted kappa coefficients. Reasons for discrepant ratings were content analysed. RESULTS: Kappa coefficients ranged from 0.37 to 1.00 and were not influenced by one-sided bias. Most kappa values were classified as excellent (n = 20) or good (n = 17) with a few items categorised as fair (n = 7) or poor (n = 1). Prevalence-adjusted kappa coefficients indicate good or excellent agreement for all but one item. Four areas contributed to scoring discrepancies: 1) clarity or sufficiency of information provided in the review; 2) information missed in the review; 3) issues encountered with the tool; and 4) issues encountered at the review level. Use of the tool demands time investment and it requires adjustment to improve its feasibility for wider use. CONCLUSIONS: The case of provider-based prevention and treatment interventions showed relevancy in developing and piloting the Ch-IMP as a useful tool for assessing the extent to which systematic reviews assess the quality of implementation. The checklist could be used by authors and editors to improve the quality of systematic reviews, and shows promise as a pedagogical tool to facilitate the extraction and reporting of implementation characteristics. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s12874-015-0037-7) contains supplementary material, which is available to authorized users.
format Online
Article
Text
id pubmed-4562191
institution National Center for Biotechnology Information
language English
publishDate 2015
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-45621912015-09-09 Development, inter-rater reliability and feasibility of a checklist to assess implementation (Ch-IMP) in systematic reviews: the case of provider-based prevention and treatment programs targeting children and youth Cargo, Margaret Stankov, Ivana Thomas, James Saini, Michael Rogers, Patricia Mayo-Wilson, Evan Hannes, Karin BMC Med Res Methodol Research Article BACKGROUND: Several papers report deficiencies in the reporting of information about the implementation of interventions in clinical trials. Information about implementation is also required in systematic reviews of complex interventions to facilitate the translation and uptake of evidence of provider-based prevention and treatment programs. To capture whether and how implementation is assessed within systematic effectiveness reviews, we developed a checklist for implementation (Ch-IMP) and piloted it in a cohort of reviews on provider-based prevention and treatment interventions for children and young people. This paper reports on the inter-rater reliability, feasibility and reasons for discrepant ratings. METHODS: Checklist domains were informed by a framework for program theory; items within domains were generated from a literature review. The checklist was pilot-tested on a cohort of 27 effectiveness reviews targeting children and youth. Two raters independently extracted information on 47 items. Inter-rater reliability was evaluated using percentage agreement and unweighted kappa coefficients. Reasons for discrepant ratings were content analysed. RESULTS: Kappa coefficients ranged from 0.37 to 1.00 and were not influenced by one-sided bias. Most kappa values were classified as excellent (n = 20) or good (n = 17) with a few items categorised as fair (n = 7) or poor (n = 1). Prevalence-adjusted kappa coefficients indicate good or excellent agreement for all but one item. Four areas contributed to scoring discrepancies: 1) clarity or sufficiency of information provided in the review; 2) information missed in the review; 3) issues encountered with the tool; and 4) issues encountered at the review level. Use of the tool demands time investment and it requires adjustment to improve its feasibility for wider use. CONCLUSIONS: The case of provider-based prevention and treatment interventions showed relevancy in developing and piloting the Ch-IMP as a useful tool for assessing the extent to which systematic reviews assess the quality of implementation. The checklist could be used by authors and editors to improve the quality of systematic reviews, and shows promise as a pedagogical tool to facilitate the extraction and reporting of implementation characteristics. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s12874-015-0037-7) contains supplementary material, which is available to authorized users. BioMed Central 2015-09-07 /pmc/articles/PMC4562191/ /pubmed/26346461 http://dx.doi.org/10.1186/s12874-015-0037-7 Text en © Cargo et al. 2015 Open Access This article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research Article
Cargo, Margaret
Stankov, Ivana
Thomas, James
Saini, Michael
Rogers, Patricia
Mayo-Wilson, Evan
Hannes, Karin
Development, inter-rater reliability and feasibility of a checklist to assess implementation (Ch-IMP) in systematic reviews: the case of provider-based prevention and treatment programs targeting children and youth
title Development, inter-rater reliability and feasibility of a checklist to assess implementation (Ch-IMP) in systematic reviews: the case of provider-based prevention and treatment programs targeting children and youth
title_full Development, inter-rater reliability and feasibility of a checklist to assess implementation (Ch-IMP) in systematic reviews: the case of provider-based prevention and treatment programs targeting children and youth
title_fullStr Development, inter-rater reliability and feasibility of a checklist to assess implementation (Ch-IMP) in systematic reviews: the case of provider-based prevention and treatment programs targeting children and youth
title_full_unstemmed Development, inter-rater reliability and feasibility of a checklist to assess implementation (Ch-IMP) in systematic reviews: the case of provider-based prevention and treatment programs targeting children and youth
title_short Development, inter-rater reliability and feasibility of a checklist to assess implementation (Ch-IMP) in systematic reviews: the case of provider-based prevention and treatment programs targeting children and youth
title_sort development, inter-rater reliability and feasibility of a checklist to assess implementation (ch-imp) in systematic reviews: the case of provider-based prevention and treatment programs targeting children and youth
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4562191/
https://www.ncbi.nlm.nih.gov/pubmed/26346461
http://dx.doi.org/10.1186/s12874-015-0037-7
work_keys_str_mv AT cargomargaret developmentinterraterreliabilityandfeasibilityofachecklisttoassessimplementationchimpinsystematicreviewsthecaseofproviderbasedpreventionandtreatmentprogramstargetingchildrenandyouth
AT stankovivana developmentinterraterreliabilityandfeasibilityofachecklisttoassessimplementationchimpinsystematicreviewsthecaseofproviderbasedpreventionandtreatmentprogramstargetingchildrenandyouth
AT thomasjames developmentinterraterreliabilityandfeasibilityofachecklisttoassessimplementationchimpinsystematicreviewsthecaseofproviderbasedpreventionandtreatmentprogramstargetingchildrenandyouth
AT sainimichael developmentinterraterreliabilityandfeasibilityofachecklisttoassessimplementationchimpinsystematicreviewsthecaseofproviderbasedpreventionandtreatmentprogramstargetingchildrenandyouth
AT rogerspatricia developmentinterraterreliabilityandfeasibilityofachecklisttoassessimplementationchimpinsystematicreviewsthecaseofproviderbasedpreventionandtreatmentprogramstargetingchildrenandyouth
AT mayowilsonevan developmentinterraterreliabilityandfeasibilityofachecklisttoassessimplementationchimpinsystematicreviewsthecaseofproviderbasedpreventionandtreatmentprogramstargetingchildrenandyouth
AT hanneskarin developmentinterraterreliabilityandfeasibilityofachecklisttoassessimplementationchimpinsystematicreviewsthecaseofproviderbasedpreventionandtreatmentprogramstargetingchildrenandyouth