Cargando…
A New Role of the Mosquito Complement-like Cascade in Male Fertility in Anopheles gambiae
Thioester-containing protein 1 (TEP1) is a key immune factor that determines mosquito resistance to a wide range of pathogens, including malaria parasites. Here we report a new allele-specific function of TEP1 in male fertility. We demonstrate that during spermatogenesis TEP1 binds to and removes da...
Autores principales: | , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Public Library of Science
2015
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4579081/ https://www.ncbi.nlm.nih.gov/pubmed/26394016 http://dx.doi.org/10.1371/journal.pbio.1002255 |
_version_ | 1782391209662087168 |
---|---|
author | Pompon, Julien Levashina, Elena A. |
author_facet | Pompon, Julien Levashina, Elena A. |
author_sort | Pompon, Julien |
collection | PubMed |
description | Thioester-containing protein 1 (TEP1) is a key immune factor that determines mosquito resistance to a wide range of pathogens, including malaria parasites. Here we report a new allele-specific function of TEP1 in male fertility. We demonstrate that during spermatogenesis TEP1 binds to and removes damaged cells through the same complement-like cascade that kills malaria parasites in the mosquito midgut. Further, higher fertility rates are mediated by an allele that renders the mosquito susceptible to Plasmodium. By elucidating the molecular and genetic mechanisms underlying TEP1 function in spermatogenesis, our study suggests that pleiotropic antagonism between reproduction and immunity may shape resistance of mosquito populations to malaria parasites. |
format | Online Article Text |
id | pubmed-4579081 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2015 |
publisher | Public Library of Science |
record_format | MEDLINE/PubMed |
spelling | pubmed-45790812015-10-01 A New Role of the Mosquito Complement-like Cascade in Male Fertility in Anopheles gambiae Pompon, Julien Levashina, Elena A. PLoS Biol Research Article Thioester-containing protein 1 (TEP1) is a key immune factor that determines mosquito resistance to a wide range of pathogens, including malaria parasites. Here we report a new allele-specific function of TEP1 in male fertility. We demonstrate that during spermatogenesis TEP1 binds to and removes damaged cells through the same complement-like cascade that kills malaria parasites in the mosquito midgut. Further, higher fertility rates are mediated by an allele that renders the mosquito susceptible to Plasmodium. By elucidating the molecular and genetic mechanisms underlying TEP1 function in spermatogenesis, our study suggests that pleiotropic antagonism between reproduction and immunity may shape resistance of mosquito populations to malaria parasites. Public Library of Science 2015-09-22 /pmc/articles/PMC4579081/ /pubmed/26394016 http://dx.doi.org/10.1371/journal.pbio.1002255 Text en © 2015 Pompon, Levashina http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are properly credited. |
spellingShingle | Research Article Pompon, Julien Levashina, Elena A. A New Role of the Mosquito Complement-like Cascade in Male Fertility in Anopheles gambiae |
title | A New Role of the Mosquito Complement-like Cascade in Male Fertility in Anopheles gambiae
|
title_full | A New Role of the Mosquito Complement-like Cascade in Male Fertility in Anopheles gambiae
|
title_fullStr | A New Role of the Mosquito Complement-like Cascade in Male Fertility in Anopheles gambiae
|
title_full_unstemmed | A New Role of the Mosquito Complement-like Cascade in Male Fertility in Anopheles gambiae
|
title_short | A New Role of the Mosquito Complement-like Cascade in Male Fertility in Anopheles gambiae
|
title_sort | new role of the mosquito complement-like cascade in male fertility in anopheles gambiae |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4579081/ https://www.ncbi.nlm.nih.gov/pubmed/26394016 http://dx.doi.org/10.1371/journal.pbio.1002255 |
work_keys_str_mv | AT pomponjulien anewroleofthemosquitocomplementlikecascadeinmalefertilityinanophelesgambiae AT levashinaelenaa anewroleofthemosquitocomplementlikecascadeinmalefertilityinanophelesgambiae AT pomponjulien newroleofthemosquitocomplementlikecascadeinmalefertilityinanophelesgambiae AT levashinaelenaa newroleofthemosquitocomplementlikecascadeinmalefertilityinanophelesgambiae |