Cargando…

A New Role of the Mosquito Complement-like Cascade in Male Fertility in Anopheles gambiae

Thioester-containing protein 1 (TEP1) is a key immune factor that determines mosquito resistance to a wide range of pathogens, including malaria parasites. Here we report a new allele-specific function of TEP1 in male fertility. We demonstrate that during spermatogenesis TEP1 binds to and removes da...

Descripción completa

Detalles Bibliográficos
Autores principales: Pompon, Julien, Levashina, Elena A.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Public Library of Science 2015
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4579081/
https://www.ncbi.nlm.nih.gov/pubmed/26394016
http://dx.doi.org/10.1371/journal.pbio.1002255
_version_ 1782391209662087168
author Pompon, Julien
Levashina, Elena A.
author_facet Pompon, Julien
Levashina, Elena A.
author_sort Pompon, Julien
collection PubMed
description Thioester-containing protein 1 (TEP1) is a key immune factor that determines mosquito resistance to a wide range of pathogens, including malaria parasites. Here we report a new allele-specific function of TEP1 in male fertility. We demonstrate that during spermatogenesis TEP1 binds to and removes damaged cells through the same complement-like cascade that kills malaria parasites in the mosquito midgut. Further, higher fertility rates are mediated by an allele that renders the mosquito susceptible to Plasmodium. By elucidating the molecular and genetic mechanisms underlying TEP1 function in spermatogenesis, our study suggests that pleiotropic antagonism between reproduction and immunity may shape resistance of mosquito populations to malaria parasites.
format Online
Article
Text
id pubmed-4579081
institution National Center for Biotechnology Information
language English
publishDate 2015
publisher Public Library of Science
record_format MEDLINE/PubMed
spelling pubmed-45790812015-10-01 A New Role of the Mosquito Complement-like Cascade in Male Fertility in Anopheles gambiae Pompon, Julien Levashina, Elena A. PLoS Biol Research Article Thioester-containing protein 1 (TEP1) is a key immune factor that determines mosquito resistance to a wide range of pathogens, including malaria parasites. Here we report a new allele-specific function of TEP1 in male fertility. We demonstrate that during spermatogenesis TEP1 binds to and removes damaged cells through the same complement-like cascade that kills malaria parasites in the mosquito midgut. Further, higher fertility rates are mediated by an allele that renders the mosquito susceptible to Plasmodium. By elucidating the molecular and genetic mechanisms underlying TEP1 function in spermatogenesis, our study suggests that pleiotropic antagonism between reproduction and immunity may shape resistance of mosquito populations to malaria parasites. Public Library of Science 2015-09-22 /pmc/articles/PMC4579081/ /pubmed/26394016 http://dx.doi.org/10.1371/journal.pbio.1002255 Text en © 2015 Pompon, Levashina http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are properly credited.
spellingShingle Research Article
Pompon, Julien
Levashina, Elena A.
A New Role of the Mosquito Complement-like Cascade in Male Fertility in Anopheles gambiae
title A New Role of the Mosquito Complement-like Cascade in Male Fertility in Anopheles gambiae
title_full A New Role of the Mosquito Complement-like Cascade in Male Fertility in Anopheles gambiae
title_fullStr A New Role of the Mosquito Complement-like Cascade in Male Fertility in Anopheles gambiae
title_full_unstemmed A New Role of the Mosquito Complement-like Cascade in Male Fertility in Anopheles gambiae
title_short A New Role of the Mosquito Complement-like Cascade in Male Fertility in Anopheles gambiae
title_sort new role of the mosquito complement-like cascade in male fertility in anopheles gambiae
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4579081/
https://www.ncbi.nlm.nih.gov/pubmed/26394016
http://dx.doi.org/10.1371/journal.pbio.1002255
work_keys_str_mv AT pomponjulien anewroleofthemosquitocomplementlikecascadeinmalefertilityinanophelesgambiae
AT levashinaelenaa anewroleofthemosquitocomplementlikecascadeinmalefertilityinanophelesgambiae
AT pomponjulien newroleofthemosquitocomplementlikecascadeinmalefertilityinanophelesgambiae
AT levashinaelenaa newroleofthemosquitocomplementlikecascadeinmalefertilityinanophelesgambiae