Cargando…

Identification of genome-specific transcripts in wheat–rye translocation lines

Studying gene expression in wheat–rye translocation lines is complicated due to the presence of homeologs in hexaploid wheat and high levels of synteny between wheat and rye genomes (Naranjo and Fernandez-Rueda, 1991 [1]; Devos et al., 1995 [2]; Lee et al., 2010 [3]; Lee et al., 2013 [4]). To overco...

Descripción completa

Detalles Bibliográficos
Autores principales: Lee, Tong Geon, Seo, Yong Weon
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Elsevier 2015
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4583666/
https://www.ncbi.nlm.nih.gov/pubmed/26484243
http://dx.doi.org/10.1016/j.gdata.2015.05.045
_version_ 1782391888335077376
author Lee, Tong Geon
Seo, Yong Weon
author_facet Lee, Tong Geon
Seo, Yong Weon
author_sort Lee, Tong Geon
collection PubMed
description Studying gene expression in wheat–rye translocation lines is complicated due to the presence of homeologs in hexaploid wheat and high levels of synteny between wheat and rye genomes (Naranjo and Fernandez-Rueda, 1991 [1]; Devos et al., 1995 [2]; Lee et al., 2010 [3]; Lee et al., 2013 [4]). To overcome limitations of current gene expression studies on wheat–rye translocation lines and identify genome-specific transcripts, we developed a custom Roche NimbleGen Gene Expression microarray that contains probes derived from the sequence of hexaploid wheat, diploid rye and diploid progenitors of hexaploid wheat genome (Lee et al., 2014). Using the array developed, we identified genome-specific transcripts in a wheat–rye translocation line (Lee et al., 2014). Expression data are deposited in the NCBI Gene Expression Omnibus (GEO) under accession number GSE58678. Here we report the details of the methods used in the array workflow and data analysis.
format Online
Article
Text
id pubmed-4583666
institution National Center for Biotechnology Information
language English
publishDate 2015
publisher Elsevier
record_format MEDLINE/PubMed
spelling pubmed-45836662015-10-19 Identification of genome-specific transcripts in wheat–rye translocation lines Lee, Tong Geon Seo, Yong Weon Genom Data Data in Brief Studying gene expression in wheat–rye translocation lines is complicated due to the presence of homeologs in hexaploid wheat and high levels of synteny between wheat and rye genomes (Naranjo and Fernandez-Rueda, 1991 [1]; Devos et al., 1995 [2]; Lee et al., 2010 [3]; Lee et al., 2013 [4]). To overcome limitations of current gene expression studies on wheat–rye translocation lines and identify genome-specific transcripts, we developed a custom Roche NimbleGen Gene Expression microarray that contains probes derived from the sequence of hexaploid wheat, diploid rye and diploid progenitors of hexaploid wheat genome (Lee et al., 2014). Using the array developed, we identified genome-specific transcripts in a wheat–rye translocation line (Lee et al., 2014). Expression data are deposited in the NCBI Gene Expression Omnibus (GEO) under accession number GSE58678. Here we report the details of the methods used in the array workflow and data analysis. Elsevier 2015-06-11 /pmc/articles/PMC4583666/ /pubmed/26484243 http://dx.doi.org/10.1016/j.gdata.2015.05.045 Text en © 2015 The Authors http://creativecommons.org/licenses/by-nc-nd/4.0/ This is an open access article under the CC BY-NC-ND license (http://creativecommons.org/licenses/by-nc-nd/4.0/).
spellingShingle Data in Brief
Lee, Tong Geon
Seo, Yong Weon
Identification of genome-specific transcripts in wheat–rye translocation lines
title Identification of genome-specific transcripts in wheat–rye translocation lines
title_full Identification of genome-specific transcripts in wheat–rye translocation lines
title_fullStr Identification of genome-specific transcripts in wheat–rye translocation lines
title_full_unstemmed Identification of genome-specific transcripts in wheat–rye translocation lines
title_short Identification of genome-specific transcripts in wheat–rye translocation lines
title_sort identification of genome-specific transcripts in wheat–rye translocation lines
topic Data in Brief
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4583666/
https://www.ncbi.nlm.nih.gov/pubmed/26484243
http://dx.doi.org/10.1016/j.gdata.2015.05.045
work_keys_str_mv AT leetonggeon identificationofgenomespecifictranscriptsinwheatryetranslocationlines
AT seoyongweon identificationofgenomespecifictranscriptsinwheatryetranslocationlines