Cargando…
International Veterinary Epilepsy Task Force recommendations for a veterinary epilepsy-specific MRI protocol
Epilepsy is one of the most common chronic neurological diseases in veterinary practice. Magnetic resonance imaging (MRI) is regarded as an important diagnostic test to reach the diagnosis of idiopathic epilepsy. However, given that the diagnosis requires the exclusion of other differentials for sei...
Autores principales: | , , , , , , , , , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2015
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4594743/ https://www.ncbi.nlm.nih.gov/pubmed/26319136 http://dx.doi.org/10.1186/s12917-015-0466-x |
_version_ | 1782393484576030720 |
---|---|
author | Rusbridge, Clare Long, Sam Jovanovik, Jelena Milne, Marjorie Berendt, Mette Bhatti, Sofie F. M. De Risio, Luisa Farqhuar, Robyn G. Fischer, Andrea Matiasek, Kaspar Muñana, Karen Patterson, Edward E. Pakozdy, Akos Penderis, Jacques Platt, Simon Podell, Michael Potschka, Heidrun Stein, Veronika M. Tipold, Andrea Volk, Holger A. |
author_facet | Rusbridge, Clare Long, Sam Jovanovik, Jelena Milne, Marjorie Berendt, Mette Bhatti, Sofie F. M. De Risio, Luisa Farqhuar, Robyn G. Fischer, Andrea Matiasek, Kaspar Muñana, Karen Patterson, Edward E. Pakozdy, Akos Penderis, Jacques Platt, Simon Podell, Michael Potschka, Heidrun Stein, Veronika M. Tipold, Andrea Volk, Holger A. |
author_sort | Rusbridge, Clare |
collection | PubMed |
description | Epilepsy is one of the most common chronic neurological diseases in veterinary practice. Magnetic resonance imaging (MRI) is regarded as an important diagnostic test to reach the diagnosis of idiopathic epilepsy. However, given that the diagnosis requires the exclusion of other differentials for seizures, the parameters for MRI examination should allow the detection of subtle lesions which may not be obvious with existing techniques. In addition, there are several differentials for idiopathic epilepsy in humans, for example some focal cortical dysplasias, which may only apparent with special sequences, imaging planes and/or particular techniques used in performing the MRI scan. As a result, there is a need to standardize MRI examination in veterinary patients with techniques that reliably diagnose subtle lesions, identify post-seizure changes, and which will allow for future identification of underlying causes of seizures not yet apparent in the veterinary literature. There is a need for a standardized veterinary epilepsy-specific MRI protocol which will facilitate more detailed examination of areas susceptible to generating and perpetuating seizures, is cost efficient, simple to perform and can be adapted for both low and high field scanners. Standardisation of imaging will improve clinical communication and uniformity of case definition between research studies. A 6–7 sequence epilepsy-specific MRI protocol for veterinary patients is proposed and further advanced MR and functional imaging is reviewed. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s12917-015-0466-x) contains supplementary material, which is available to authorized users. |
format | Online Article Text |
id | pubmed-4594743 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2015 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-45947432015-10-07 International Veterinary Epilepsy Task Force recommendations for a veterinary epilepsy-specific MRI protocol Rusbridge, Clare Long, Sam Jovanovik, Jelena Milne, Marjorie Berendt, Mette Bhatti, Sofie F. M. De Risio, Luisa Farqhuar, Robyn G. Fischer, Andrea Matiasek, Kaspar Muñana, Karen Patterson, Edward E. Pakozdy, Akos Penderis, Jacques Platt, Simon Podell, Michael Potschka, Heidrun Stein, Veronika M. Tipold, Andrea Volk, Holger A. BMC Vet Res Correspondence Epilepsy is one of the most common chronic neurological diseases in veterinary practice. Magnetic resonance imaging (MRI) is regarded as an important diagnostic test to reach the diagnosis of idiopathic epilepsy. However, given that the diagnosis requires the exclusion of other differentials for seizures, the parameters for MRI examination should allow the detection of subtle lesions which may not be obvious with existing techniques. In addition, there are several differentials for idiopathic epilepsy in humans, for example some focal cortical dysplasias, which may only apparent with special sequences, imaging planes and/or particular techniques used in performing the MRI scan. As a result, there is a need to standardize MRI examination in veterinary patients with techniques that reliably diagnose subtle lesions, identify post-seizure changes, and which will allow for future identification of underlying causes of seizures not yet apparent in the veterinary literature. There is a need for a standardized veterinary epilepsy-specific MRI protocol which will facilitate more detailed examination of areas susceptible to generating and perpetuating seizures, is cost efficient, simple to perform and can be adapted for both low and high field scanners. Standardisation of imaging will improve clinical communication and uniformity of case definition between research studies. A 6–7 sequence epilepsy-specific MRI protocol for veterinary patients is proposed and further advanced MR and functional imaging is reviewed. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s12917-015-0466-x) contains supplementary material, which is available to authorized users. BioMed Central 2015-08-28 /pmc/articles/PMC4594743/ /pubmed/26319136 http://dx.doi.org/10.1186/s12917-015-0466-x Text en © Rusbridge et al. 2015 This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly credited. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Correspondence Rusbridge, Clare Long, Sam Jovanovik, Jelena Milne, Marjorie Berendt, Mette Bhatti, Sofie F. M. De Risio, Luisa Farqhuar, Robyn G. Fischer, Andrea Matiasek, Kaspar Muñana, Karen Patterson, Edward E. Pakozdy, Akos Penderis, Jacques Platt, Simon Podell, Michael Potschka, Heidrun Stein, Veronika M. Tipold, Andrea Volk, Holger A. International Veterinary Epilepsy Task Force recommendations for a veterinary epilepsy-specific MRI protocol |
title | International Veterinary Epilepsy Task Force recommendations for a veterinary epilepsy-specific MRI protocol |
title_full | International Veterinary Epilepsy Task Force recommendations for a veterinary epilepsy-specific MRI protocol |
title_fullStr | International Veterinary Epilepsy Task Force recommendations for a veterinary epilepsy-specific MRI protocol |
title_full_unstemmed | International Veterinary Epilepsy Task Force recommendations for a veterinary epilepsy-specific MRI protocol |
title_short | International Veterinary Epilepsy Task Force recommendations for a veterinary epilepsy-specific MRI protocol |
title_sort | international veterinary epilepsy task force recommendations for a veterinary epilepsy-specific mri protocol |
topic | Correspondence |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4594743/ https://www.ncbi.nlm.nih.gov/pubmed/26319136 http://dx.doi.org/10.1186/s12917-015-0466-x |
work_keys_str_mv | AT rusbridgeclare internationalveterinaryepilepsytaskforcerecommendationsforaveterinaryepilepsyspecificmriprotocol AT longsam internationalveterinaryepilepsytaskforcerecommendationsforaveterinaryepilepsyspecificmriprotocol AT jovanovikjelena internationalveterinaryepilepsytaskforcerecommendationsforaveterinaryepilepsyspecificmriprotocol AT milnemarjorie internationalveterinaryepilepsytaskforcerecommendationsforaveterinaryepilepsyspecificmriprotocol AT berendtmette internationalveterinaryepilepsytaskforcerecommendationsforaveterinaryepilepsyspecificmriprotocol AT bhattisofiefm internationalveterinaryepilepsytaskforcerecommendationsforaveterinaryepilepsyspecificmriprotocol AT derisioluisa internationalveterinaryepilepsytaskforcerecommendationsforaveterinaryepilepsyspecificmriprotocol AT farqhuarrobyng internationalveterinaryepilepsytaskforcerecommendationsforaveterinaryepilepsyspecificmriprotocol AT fischerandrea internationalveterinaryepilepsytaskforcerecommendationsforaveterinaryepilepsyspecificmriprotocol AT matiasekkaspar internationalveterinaryepilepsytaskforcerecommendationsforaveterinaryepilepsyspecificmriprotocol AT munanakaren internationalveterinaryepilepsytaskforcerecommendationsforaveterinaryepilepsyspecificmriprotocol AT pattersonedwarde internationalveterinaryepilepsytaskforcerecommendationsforaveterinaryepilepsyspecificmriprotocol AT pakozdyakos internationalveterinaryepilepsytaskforcerecommendationsforaveterinaryepilepsyspecificmriprotocol AT penderisjacques internationalveterinaryepilepsytaskforcerecommendationsforaveterinaryepilepsyspecificmriprotocol AT plattsimon internationalveterinaryepilepsytaskforcerecommendationsforaveterinaryepilepsyspecificmriprotocol AT podellmichael internationalveterinaryepilepsytaskforcerecommendationsforaveterinaryepilepsyspecificmriprotocol AT potschkaheidrun internationalveterinaryepilepsytaskforcerecommendationsforaveterinaryepilepsyspecificmriprotocol AT steinveronikam internationalveterinaryepilepsytaskforcerecommendationsforaveterinaryepilepsyspecificmriprotocol AT tipoldandrea internationalveterinaryepilepsytaskforcerecommendationsforaveterinaryepilepsyspecificmriprotocol AT volkholgera internationalveterinaryepilepsytaskforcerecommendationsforaveterinaryepilepsyspecificmriprotocol |