Cargando…

International Veterinary Epilepsy Task Force recommendations for a veterinary epilepsy-specific MRI protocol

Epilepsy is one of the most common chronic neurological diseases in veterinary practice. Magnetic resonance imaging (MRI) is regarded as an important diagnostic test to reach the diagnosis of idiopathic epilepsy. However, given that the diagnosis requires the exclusion of other differentials for sei...

Descripción completa

Detalles Bibliográficos
Autores principales: Rusbridge, Clare, Long, Sam, Jovanovik, Jelena, Milne, Marjorie, Berendt, Mette, Bhatti, Sofie F. M., De Risio, Luisa, Farqhuar, Robyn G., Fischer, Andrea, Matiasek, Kaspar, Muñana, Karen, Patterson, Edward E., Pakozdy, Akos, Penderis, Jacques, Platt, Simon, Podell, Michael, Potschka, Heidrun, Stein, Veronika M., Tipold, Andrea, Volk, Holger A.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2015
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4594743/
https://www.ncbi.nlm.nih.gov/pubmed/26319136
http://dx.doi.org/10.1186/s12917-015-0466-x
_version_ 1782393484576030720
author Rusbridge, Clare
Long, Sam
Jovanovik, Jelena
Milne, Marjorie
Berendt, Mette
Bhatti, Sofie F. M.
De Risio, Luisa
Farqhuar, Robyn G.
Fischer, Andrea
Matiasek, Kaspar
Muñana, Karen
Patterson, Edward E.
Pakozdy, Akos
Penderis, Jacques
Platt, Simon
Podell, Michael
Potschka, Heidrun
Stein, Veronika M.
Tipold, Andrea
Volk, Holger A.
author_facet Rusbridge, Clare
Long, Sam
Jovanovik, Jelena
Milne, Marjorie
Berendt, Mette
Bhatti, Sofie F. M.
De Risio, Luisa
Farqhuar, Robyn G.
Fischer, Andrea
Matiasek, Kaspar
Muñana, Karen
Patterson, Edward E.
Pakozdy, Akos
Penderis, Jacques
Platt, Simon
Podell, Michael
Potschka, Heidrun
Stein, Veronika M.
Tipold, Andrea
Volk, Holger A.
author_sort Rusbridge, Clare
collection PubMed
description Epilepsy is one of the most common chronic neurological diseases in veterinary practice. Magnetic resonance imaging (MRI) is regarded as an important diagnostic test to reach the diagnosis of idiopathic epilepsy. However, given that the diagnosis requires the exclusion of other differentials for seizures, the parameters for MRI examination should allow the detection of subtle lesions which may not be obvious with existing techniques. In addition, there are several differentials for idiopathic epilepsy in humans, for example some focal cortical dysplasias, which may only apparent with special sequences, imaging planes and/or particular techniques used in performing the MRI scan. As a result, there is a need to standardize MRI examination in veterinary patients with techniques that reliably diagnose subtle lesions, identify post-seizure changes, and which will allow for future identification of underlying causes of seizures not yet apparent in the veterinary literature. There is a need for a standardized veterinary epilepsy-specific MRI protocol which will facilitate more detailed examination of areas susceptible to generating and perpetuating seizures, is cost efficient, simple to perform and can be adapted for both low and high field scanners. Standardisation of imaging will improve clinical communication and uniformity of case definition between research studies. A 6–7 sequence epilepsy-specific MRI protocol for veterinary patients is proposed and further advanced MR and functional imaging is reviewed. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s12917-015-0466-x) contains supplementary material, which is available to authorized users.
format Online
Article
Text
id pubmed-4594743
institution National Center for Biotechnology Information
language English
publishDate 2015
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-45947432015-10-07 International Veterinary Epilepsy Task Force recommendations for a veterinary epilepsy-specific MRI protocol Rusbridge, Clare Long, Sam Jovanovik, Jelena Milne, Marjorie Berendt, Mette Bhatti, Sofie F. M. De Risio, Luisa Farqhuar, Robyn G. Fischer, Andrea Matiasek, Kaspar Muñana, Karen Patterson, Edward E. Pakozdy, Akos Penderis, Jacques Platt, Simon Podell, Michael Potschka, Heidrun Stein, Veronika M. Tipold, Andrea Volk, Holger A. BMC Vet Res Correspondence Epilepsy is one of the most common chronic neurological diseases in veterinary practice. Magnetic resonance imaging (MRI) is regarded as an important diagnostic test to reach the diagnosis of idiopathic epilepsy. However, given that the diagnosis requires the exclusion of other differentials for seizures, the parameters for MRI examination should allow the detection of subtle lesions which may not be obvious with existing techniques. In addition, there are several differentials for idiopathic epilepsy in humans, for example some focal cortical dysplasias, which may only apparent with special sequences, imaging planes and/or particular techniques used in performing the MRI scan. As a result, there is a need to standardize MRI examination in veterinary patients with techniques that reliably diagnose subtle lesions, identify post-seizure changes, and which will allow for future identification of underlying causes of seizures not yet apparent in the veterinary literature. There is a need for a standardized veterinary epilepsy-specific MRI protocol which will facilitate more detailed examination of areas susceptible to generating and perpetuating seizures, is cost efficient, simple to perform and can be adapted for both low and high field scanners. Standardisation of imaging will improve clinical communication and uniformity of case definition between research studies. A 6–7 sequence epilepsy-specific MRI protocol for veterinary patients is proposed and further advanced MR and functional imaging is reviewed. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s12917-015-0466-x) contains supplementary material, which is available to authorized users. BioMed Central 2015-08-28 /pmc/articles/PMC4594743/ /pubmed/26319136 http://dx.doi.org/10.1186/s12917-015-0466-x Text en © Rusbridge et al. 2015 This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly credited. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Correspondence
Rusbridge, Clare
Long, Sam
Jovanovik, Jelena
Milne, Marjorie
Berendt, Mette
Bhatti, Sofie F. M.
De Risio, Luisa
Farqhuar, Robyn G.
Fischer, Andrea
Matiasek, Kaspar
Muñana, Karen
Patterson, Edward E.
Pakozdy, Akos
Penderis, Jacques
Platt, Simon
Podell, Michael
Potschka, Heidrun
Stein, Veronika M.
Tipold, Andrea
Volk, Holger A.
International Veterinary Epilepsy Task Force recommendations for a veterinary epilepsy-specific MRI protocol
title International Veterinary Epilepsy Task Force recommendations for a veterinary epilepsy-specific MRI protocol
title_full International Veterinary Epilepsy Task Force recommendations for a veterinary epilepsy-specific MRI protocol
title_fullStr International Veterinary Epilepsy Task Force recommendations for a veterinary epilepsy-specific MRI protocol
title_full_unstemmed International Veterinary Epilepsy Task Force recommendations for a veterinary epilepsy-specific MRI protocol
title_short International Veterinary Epilepsy Task Force recommendations for a veterinary epilepsy-specific MRI protocol
title_sort international veterinary epilepsy task force recommendations for a veterinary epilepsy-specific mri protocol
topic Correspondence
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4594743/
https://www.ncbi.nlm.nih.gov/pubmed/26319136
http://dx.doi.org/10.1186/s12917-015-0466-x
work_keys_str_mv AT rusbridgeclare internationalveterinaryepilepsytaskforcerecommendationsforaveterinaryepilepsyspecificmriprotocol
AT longsam internationalveterinaryepilepsytaskforcerecommendationsforaveterinaryepilepsyspecificmriprotocol
AT jovanovikjelena internationalveterinaryepilepsytaskforcerecommendationsforaveterinaryepilepsyspecificmriprotocol
AT milnemarjorie internationalveterinaryepilepsytaskforcerecommendationsforaveterinaryepilepsyspecificmriprotocol
AT berendtmette internationalveterinaryepilepsytaskforcerecommendationsforaveterinaryepilepsyspecificmriprotocol
AT bhattisofiefm internationalveterinaryepilepsytaskforcerecommendationsforaveterinaryepilepsyspecificmriprotocol
AT derisioluisa internationalveterinaryepilepsytaskforcerecommendationsforaveterinaryepilepsyspecificmriprotocol
AT farqhuarrobyng internationalveterinaryepilepsytaskforcerecommendationsforaveterinaryepilepsyspecificmriprotocol
AT fischerandrea internationalveterinaryepilepsytaskforcerecommendationsforaveterinaryepilepsyspecificmriprotocol
AT matiasekkaspar internationalveterinaryepilepsytaskforcerecommendationsforaveterinaryepilepsyspecificmriprotocol
AT munanakaren internationalveterinaryepilepsytaskforcerecommendationsforaveterinaryepilepsyspecificmriprotocol
AT pattersonedwarde internationalveterinaryepilepsytaskforcerecommendationsforaveterinaryepilepsyspecificmriprotocol
AT pakozdyakos internationalveterinaryepilepsytaskforcerecommendationsforaveterinaryepilepsyspecificmriprotocol
AT penderisjacques internationalveterinaryepilepsytaskforcerecommendationsforaveterinaryepilepsyspecificmriprotocol
AT plattsimon internationalveterinaryepilepsytaskforcerecommendationsforaveterinaryepilepsyspecificmriprotocol
AT podellmichael internationalveterinaryepilepsytaskforcerecommendationsforaveterinaryepilepsyspecificmriprotocol
AT potschkaheidrun internationalveterinaryepilepsytaskforcerecommendationsforaveterinaryepilepsyspecificmriprotocol
AT steinveronikam internationalveterinaryepilepsytaskforcerecommendationsforaveterinaryepilepsyspecificmriprotocol
AT tipoldandrea internationalveterinaryepilepsytaskforcerecommendationsforaveterinaryepilepsyspecificmriprotocol
AT volkholgera internationalveterinaryepilepsytaskforcerecommendationsforaveterinaryepilepsyspecificmriprotocol