Cargando…
Interstitial lung disease in STING-associated vasculopathy with onset in infancy (SAVI): preliminary genotype-phenotype correlation
| Autores principales: | , , , , , , , , , , , , , , , , , , , , , , , , , |
|---|---|
| Formato: | Online Artículo Texto |
| Lenguaje: | English |
| Publicado: |
BioMed Central
2015
|
| Materias: | |
| Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4596964/ http://dx.doi.org/10.1186/1546-0096-13-S1-O32 |
| _version_ | 1782393839716139008 |
|---|---|
| author | Malle, L Marrero, B Liu, Y Montealegre, G Chapelle, D Kim, H O'Brien, M Hill, S Fontana, JR Ramsey, S Duckers, G Ozen, S Issekutz, A Wittkowski, H Foell, D Tenbrock, K Jones, O Holland, S Gonzalez, B Brogan, P Omoyinmi, E Gomes, S Melo Paller, A Deng, Z Goldback-Mansky, R de Jesus, A Almeida |
| author_facet | Malle, L Marrero, B Liu, Y Montealegre, G Chapelle, D Kim, H O'Brien, M Hill, S Fontana, JR Ramsey, S Duckers, G Ozen, S Issekutz, A Wittkowski, H Foell, D Tenbrock, K Jones, O Holland, S Gonzalez, B Brogan, P Omoyinmi, E Gomes, S Melo Paller, A Deng, Z Goldback-Mansky, R de Jesus, A Almeida |
| author_sort | Malle, L |
| collection | PubMed |
| description | |
| format | Online Article Text |
| id | pubmed-4596964 |
| institution | National Center for Biotechnology Information |
| language | English |
| publishDate | 2015 |
| publisher | BioMed Central |
| record_format | MEDLINE/PubMed |
| spelling | pubmed-45969642015-10-08 Interstitial lung disease in STING-associated vasculopathy with onset in infancy (SAVI): preliminary genotype-phenotype correlation Malle, L Marrero, B Liu, Y Montealegre, G Chapelle, D Kim, H O'Brien, M Hill, S Fontana, JR Ramsey, S Duckers, G Ozen, S Issekutz, A Wittkowski, H Foell, D Tenbrock, K Jones, O Holland, S Gonzalez, B Brogan, P Omoyinmi, E Gomes, S Melo Paller, A Deng, Z Goldback-Mansky, R de Jesus, A Almeida Pediatr Rheumatol Online J Oral Presentation BioMed Central 2015-09-28 /pmc/articles/PMC4596964/ http://dx.doi.org/10.1186/1546-0096-13-S1-O32 Text en Copyright © 2015 Malle et al. http://creativecommons.org/licenses/by/4.0 This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
| spellingShingle | Oral Presentation Malle, L Marrero, B Liu, Y Montealegre, G Chapelle, D Kim, H O'Brien, M Hill, S Fontana, JR Ramsey, S Duckers, G Ozen, S Issekutz, A Wittkowski, H Foell, D Tenbrock, K Jones, O Holland, S Gonzalez, B Brogan, P Omoyinmi, E Gomes, S Melo Paller, A Deng, Z Goldback-Mansky, R de Jesus, A Almeida Interstitial lung disease in STING-associated vasculopathy with onset in infancy (SAVI): preliminary genotype-phenotype correlation |
| title | Interstitial lung disease in STING-associated vasculopathy with onset in infancy (SAVI): preliminary genotype-phenotype correlation |
| title_full | Interstitial lung disease in STING-associated vasculopathy with onset in infancy (SAVI): preliminary genotype-phenotype correlation |
| title_fullStr | Interstitial lung disease in STING-associated vasculopathy with onset in infancy (SAVI): preliminary genotype-phenotype correlation |
| title_full_unstemmed | Interstitial lung disease in STING-associated vasculopathy with onset in infancy (SAVI): preliminary genotype-phenotype correlation |
| title_short | Interstitial lung disease in STING-associated vasculopathy with onset in infancy (SAVI): preliminary genotype-phenotype correlation |
| title_sort | interstitial lung disease in sting-associated vasculopathy with onset in infancy (savi): preliminary genotype-phenotype correlation |
| topic | Oral Presentation |
| url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4596964/ http://dx.doi.org/10.1186/1546-0096-13-S1-O32 |
| work_keys_str_mv | AT mallel interstitiallungdiseaseinstingassociatedvasculopathywithonsetininfancysavipreliminarygenotypephenotypecorrelation AT marrerob interstitiallungdiseaseinstingassociatedvasculopathywithonsetininfancysavipreliminarygenotypephenotypecorrelation AT liuy interstitiallungdiseaseinstingassociatedvasculopathywithonsetininfancysavipreliminarygenotypephenotypecorrelation AT montealegreg interstitiallungdiseaseinstingassociatedvasculopathywithonsetininfancysavipreliminarygenotypephenotypecorrelation AT chapelled interstitiallungdiseaseinstingassociatedvasculopathywithonsetininfancysavipreliminarygenotypephenotypecorrelation AT kimh interstitiallungdiseaseinstingassociatedvasculopathywithonsetininfancysavipreliminarygenotypephenotypecorrelation AT obrienm interstitiallungdiseaseinstingassociatedvasculopathywithonsetininfancysavipreliminarygenotypephenotypecorrelation AT hills interstitiallungdiseaseinstingassociatedvasculopathywithonsetininfancysavipreliminarygenotypephenotypecorrelation AT fontanajr interstitiallungdiseaseinstingassociatedvasculopathywithonsetininfancysavipreliminarygenotypephenotypecorrelation AT ramseys interstitiallungdiseaseinstingassociatedvasculopathywithonsetininfancysavipreliminarygenotypephenotypecorrelation AT duckersg interstitiallungdiseaseinstingassociatedvasculopathywithonsetininfancysavipreliminarygenotypephenotypecorrelation AT ozens interstitiallungdiseaseinstingassociatedvasculopathywithonsetininfancysavipreliminarygenotypephenotypecorrelation AT issekutza interstitiallungdiseaseinstingassociatedvasculopathywithonsetininfancysavipreliminarygenotypephenotypecorrelation AT wittkowskih interstitiallungdiseaseinstingassociatedvasculopathywithonsetininfancysavipreliminarygenotypephenotypecorrelation AT foelld interstitiallungdiseaseinstingassociatedvasculopathywithonsetininfancysavipreliminarygenotypephenotypecorrelation AT tenbrockk interstitiallungdiseaseinstingassociatedvasculopathywithonsetininfancysavipreliminarygenotypephenotypecorrelation AT joneso interstitiallungdiseaseinstingassociatedvasculopathywithonsetininfancysavipreliminarygenotypephenotypecorrelation AT hollands interstitiallungdiseaseinstingassociatedvasculopathywithonsetininfancysavipreliminarygenotypephenotypecorrelation AT gonzalezb interstitiallungdiseaseinstingassociatedvasculopathywithonsetininfancysavipreliminarygenotypephenotypecorrelation AT broganp interstitiallungdiseaseinstingassociatedvasculopathywithonsetininfancysavipreliminarygenotypephenotypecorrelation AT omoyinmie interstitiallungdiseaseinstingassociatedvasculopathywithonsetininfancysavipreliminarygenotypephenotypecorrelation AT gomessmelo interstitiallungdiseaseinstingassociatedvasculopathywithonsetininfancysavipreliminarygenotypephenotypecorrelation AT pallera interstitiallungdiseaseinstingassociatedvasculopathywithonsetininfancysavipreliminarygenotypephenotypecorrelation AT dengz interstitiallungdiseaseinstingassociatedvasculopathywithonsetininfancysavipreliminarygenotypephenotypecorrelation AT goldbackmanskyr interstitiallungdiseaseinstingassociatedvasculopathywithonsetininfancysavipreliminarygenotypephenotypecorrelation AT dejesusaalmeida interstitiallungdiseaseinstingassociatedvasculopathywithonsetininfancysavipreliminarygenotypephenotypecorrelation |