Cargando…

Kawasaki Disease Mimicking a Parapharyngeal Abscess: A Case Report

Parapharyngeal abscess (PPA)-like lesion is a very rare manifestation of Kawasaki disease (KD). Here we report a Chinese case of KD initially mimicking PPA, which is the first one reported in Asia. A 3-year-old male patient presented with fever, drooling, and bilateral painful cervical lymphadenopat...

Descripción completa

Detalles Bibliográficos
Autores principales: Cai, Qianyun, Luo, Rong, Gan, Jing, Zhang, Li, Qu, Yi, Mu, Dezhi
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Wolters Kluwer Health 2015
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4603063/
https://www.ncbi.nlm.nih.gov/pubmed/25929913
http://dx.doi.org/10.1097/MD.0000000000000761
_version_ 1782394854695763968
author Cai, Qianyun
Luo, Rong
Gan, Jing
Zhang, Li
Qu, Yi
Mu, Dezhi
author_facet Cai, Qianyun
Luo, Rong
Gan, Jing
Zhang, Li
Qu, Yi
Mu, Dezhi
author_sort Cai, Qianyun
collection PubMed
description Parapharyngeal abscess (PPA)-like lesion is a very rare manifestation of Kawasaki disease (KD). Here we report a Chinese case of KD initially mimicking PPA, which is the first one reported in Asia. A 3-year-old male patient presented with fever, drooling, and bilateral painful cervical lymphadenopathy for 3 days. Chest X-ray and echocardiogram were normal. With substantial elevation of white blood count and C-reactive protein, purulent cervical lymphadenitis was considered. Symptoms did not improve after treatment with vancomycin, and the patient further developed trismus and restricted neck movement. Neck CT revealed a 2 × 1.5 cm hypodense lesion in the right parapharyngeal space with peripheral enhancement. PPA was suspected and on the 3rd day following admission, the patient received surgical incision and drainage. One milliliter of serous fluid was drained without bacterial growth on cultures. Fever persisted after surgery. As the clinical course proceeded, additional major signs of KD gradually evolved, and on the 6th day following admission the patient completely fulfilled the diagnostic criteria for KD. Rapid clinical improvement was observed following treatment with high-dose immunoglobulin and aspirin. Due to the parapharyngeal operation, the patient was fed milk through a nasogastric tube for 15 days. His neck incision became infected but healed gradually following dressing change and antibiotic treatment. Currently he remains asymptomatic during regular follow-up and repeated echocardiograms are normal. Both pediatricians and otolaryngologists can learn from this case that KD may initially manifest as PPA. Careful observation for major signs of KD during the clinical course can help to achieve a prompt and correct diagnosis. Thus, unnecessary surgery and cardiac complications of KD may be avoided.
format Online
Article
Text
id pubmed-4603063
institution National Center for Biotechnology Information
language English
publishDate 2015
publisher Wolters Kluwer Health
record_format MEDLINE/PubMed
spelling pubmed-46030632015-10-27 Kawasaki Disease Mimicking a Parapharyngeal Abscess: A Case Report Cai, Qianyun Luo, Rong Gan, Jing Zhang, Li Qu, Yi Mu, Dezhi Medicine (Baltimore) 6200 Parapharyngeal abscess (PPA)-like lesion is a very rare manifestation of Kawasaki disease (KD). Here we report a Chinese case of KD initially mimicking PPA, which is the first one reported in Asia. A 3-year-old male patient presented with fever, drooling, and bilateral painful cervical lymphadenopathy for 3 days. Chest X-ray and echocardiogram were normal. With substantial elevation of white blood count and C-reactive protein, purulent cervical lymphadenitis was considered. Symptoms did not improve after treatment with vancomycin, and the patient further developed trismus and restricted neck movement. Neck CT revealed a 2 × 1.5 cm hypodense lesion in the right parapharyngeal space with peripheral enhancement. PPA was suspected and on the 3rd day following admission, the patient received surgical incision and drainage. One milliliter of serous fluid was drained without bacterial growth on cultures. Fever persisted after surgery. As the clinical course proceeded, additional major signs of KD gradually evolved, and on the 6th day following admission the patient completely fulfilled the diagnostic criteria for KD. Rapid clinical improvement was observed following treatment with high-dose immunoglobulin and aspirin. Due to the parapharyngeal operation, the patient was fed milk through a nasogastric tube for 15 days. His neck incision became infected but healed gradually following dressing change and antibiotic treatment. Currently he remains asymptomatic during regular follow-up and repeated echocardiograms are normal. Both pediatricians and otolaryngologists can learn from this case that KD may initially manifest as PPA. Careful observation for major signs of KD during the clinical course can help to achieve a prompt and correct diagnosis. Thus, unnecessary surgery and cardiac complications of KD may be avoided. Wolters Kluwer Health 2015-05-01 /pmc/articles/PMC4603063/ /pubmed/25929913 http://dx.doi.org/10.1097/MD.0000000000000761 Text en Copyright © 2015 Wolters Kluwer Health, Inc. All rights reserved. http://creativecommons.org/licenses/by-nc-sa/4.0 This is an open access article distributed under the terms of the Creative Commons Attribution-NonCommercial-ShareAlike 4.0 License, which allows others to remix, tweak, and build upon the work non-commercially, as long as the author is credited and the new creations are licensed under the identical terms. http://creativecommons.org/licenses/by-nc-sa/4.0
spellingShingle 6200
Cai, Qianyun
Luo, Rong
Gan, Jing
Zhang, Li
Qu, Yi
Mu, Dezhi
Kawasaki Disease Mimicking a Parapharyngeal Abscess: A Case Report
title Kawasaki Disease Mimicking a Parapharyngeal Abscess: A Case Report
title_full Kawasaki Disease Mimicking a Parapharyngeal Abscess: A Case Report
title_fullStr Kawasaki Disease Mimicking a Parapharyngeal Abscess: A Case Report
title_full_unstemmed Kawasaki Disease Mimicking a Parapharyngeal Abscess: A Case Report
title_short Kawasaki Disease Mimicking a Parapharyngeal Abscess: A Case Report
title_sort kawasaki disease mimicking a parapharyngeal abscess: a case report
topic 6200
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4603063/
https://www.ncbi.nlm.nih.gov/pubmed/25929913
http://dx.doi.org/10.1097/MD.0000000000000761
work_keys_str_mv AT caiqianyun kawasakidiseasemimickingaparapharyngealabscessacasereport
AT luorong kawasakidiseasemimickingaparapharyngealabscessacasereport
AT ganjing kawasakidiseasemimickingaparapharyngealabscessacasereport
AT zhangli kawasakidiseasemimickingaparapharyngealabscessacasereport
AT quyi kawasakidiseasemimickingaparapharyngealabscessacasereport
AT mudezhi kawasakidiseasemimickingaparapharyngealabscessacasereport