Cargando…

Construction of a high-density linkage map and fine mapping of QTL for growth in Asian seabass

A high-density genetic map is essential for comparative genomic studies and fine mapping of QTL, and can also facilitate genome sequence assembly. Here, a high density genetic map of Asian seabass was constructed with 3321 SNPs generated by sequencing 144 individuals in a F(2) family. The length of...

Descripción completa

Detalles Bibliográficos
Autores principales: Wang, Le, Wan, Zi Yi, Bai, Bin, Huang, Shu Qing, Chua, Elaine, Lee, May, Pang, Hong Yan, Wen, Yan Fei, Liu, Peng, Liu, Feng, Sun, Fei, Lin, Grace, Ye, Bao Qing, Yue, Gen Hua
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Nature Publishing Group 2015
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4639833/
https://www.ncbi.nlm.nih.gov/pubmed/26553309
http://dx.doi.org/10.1038/srep16358
_version_ 1782399994493403136
author Wang, Le
Wan, Zi Yi
Bai, Bin
Huang, Shu Qing
Chua, Elaine
Lee, May
Pang, Hong Yan
Wen, Yan Fei
Liu, Peng
Liu, Feng
Sun, Fei
Lin, Grace
Ye, Bao Qing
Yue, Gen Hua
author_facet Wang, Le
Wan, Zi Yi
Bai, Bin
Huang, Shu Qing
Chua, Elaine
Lee, May
Pang, Hong Yan
Wen, Yan Fei
Liu, Peng
Liu, Feng
Sun, Fei
Lin, Grace
Ye, Bao Qing
Yue, Gen Hua
author_sort Wang, Le
collection PubMed
description A high-density genetic map is essential for comparative genomic studies and fine mapping of QTL, and can also facilitate genome sequence assembly. Here, a high density genetic map of Asian seabass was constructed with 3321 SNPs generated by sequencing 144 individuals in a F(2) family. The length of the map was 1577.67 cM with an average marker interval of 0.52 cM. A high level of genomic synteny among Asian seabass, European seabass, Nile tilapia and stickleback was detected. Using this map, one genome-wide significant and five suggestive QTL for growth traits were detected in six linkage groups (i.e. LG4, LG5, LG11, LG13, LG14 and LG15). These QTL explained 10.5–16.0% of phenotypic variance. A candidate gene, ACOX1 within the significant QTL on LG5 was identified. The gene was differentially expressed between fast- and slow-growing Asian seabass. The high-density SNP-based map provides an important tool for fine mapping QTL in molecular breeding and comparative genome analysis.
format Online
Article
Text
id pubmed-4639833
institution National Center for Biotechnology Information
language English
publishDate 2015
publisher Nature Publishing Group
record_format MEDLINE/PubMed
spelling pubmed-46398332015-11-16 Construction of a high-density linkage map and fine mapping of QTL for growth in Asian seabass Wang, Le Wan, Zi Yi Bai, Bin Huang, Shu Qing Chua, Elaine Lee, May Pang, Hong Yan Wen, Yan Fei Liu, Peng Liu, Feng Sun, Fei Lin, Grace Ye, Bao Qing Yue, Gen Hua Sci Rep Article A high-density genetic map is essential for comparative genomic studies and fine mapping of QTL, and can also facilitate genome sequence assembly. Here, a high density genetic map of Asian seabass was constructed with 3321 SNPs generated by sequencing 144 individuals in a F(2) family. The length of the map was 1577.67 cM with an average marker interval of 0.52 cM. A high level of genomic synteny among Asian seabass, European seabass, Nile tilapia and stickleback was detected. Using this map, one genome-wide significant and five suggestive QTL for growth traits were detected in six linkage groups (i.e. LG4, LG5, LG11, LG13, LG14 and LG15). These QTL explained 10.5–16.0% of phenotypic variance. A candidate gene, ACOX1 within the significant QTL on LG5 was identified. The gene was differentially expressed between fast- and slow-growing Asian seabass. The high-density SNP-based map provides an important tool for fine mapping QTL in molecular breeding and comparative genome analysis. Nature Publishing Group 2015-11-10 /pmc/articles/PMC4639833/ /pubmed/26553309 http://dx.doi.org/10.1038/srep16358 Text en Copyright © 2015, Macmillan Publishers Limited http://creativecommons.org/licenses/by/4.0/ This work is licensed under a Creative Commons Attribution 4.0 International License. The images or other third party material in this article are included in the article’s Creative Commons license, unless indicated otherwise in the credit line; if the material is not included under the Creative Commons license, users will need to obtain permission from the license holder to reproduce the material. To view a copy of this license, visit http://creativecommons.org/licenses/by/4.0/
spellingShingle Article
Wang, Le
Wan, Zi Yi
Bai, Bin
Huang, Shu Qing
Chua, Elaine
Lee, May
Pang, Hong Yan
Wen, Yan Fei
Liu, Peng
Liu, Feng
Sun, Fei
Lin, Grace
Ye, Bao Qing
Yue, Gen Hua
Construction of a high-density linkage map and fine mapping of QTL for growth in Asian seabass
title Construction of a high-density linkage map and fine mapping of QTL for growth in Asian seabass
title_full Construction of a high-density linkage map and fine mapping of QTL for growth in Asian seabass
title_fullStr Construction of a high-density linkage map and fine mapping of QTL for growth in Asian seabass
title_full_unstemmed Construction of a high-density linkage map and fine mapping of QTL for growth in Asian seabass
title_short Construction of a high-density linkage map and fine mapping of QTL for growth in Asian seabass
title_sort construction of a high-density linkage map and fine mapping of qtl for growth in asian seabass
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4639833/
https://www.ncbi.nlm.nih.gov/pubmed/26553309
http://dx.doi.org/10.1038/srep16358
work_keys_str_mv AT wangle constructionofahighdensitylinkagemapandfinemappingofqtlforgrowthinasianseabass
AT wanziyi constructionofahighdensitylinkagemapandfinemappingofqtlforgrowthinasianseabass
AT baibin constructionofahighdensitylinkagemapandfinemappingofqtlforgrowthinasianseabass
AT huangshuqing constructionofahighdensitylinkagemapandfinemappingofqtlforgrowthinasianseabass
AT chuaelaine constructionofahighdensitylinkagemapandfinemappingofqtlforgrowthinasianseabass
AT leemay constructionofahighdensitylinkagemapandfinemappingofqtlforgrowthinasianseabass
AT panghongyan constructionofahighdensitylinkagemapandfinemappingofqtlforgrowthinasianseabass
AT wenyanfei constructionofahighdensitylinkagemapandfinemappingofqtlforgrowthinasianseabass
AT liupeng constructionofahighdensitylinkagemapandfinemappingofqtlforgrowthinasianseabass
AT liufeng constructionofahighdensitylinkagemapandfinemappingofqtlforgrowthinasianseabass
AT sunfei constructionofahighdensitylinkagemapandfinemappingofqtlforgrowthinasianseabass
AT lingrace constructionofahighdensitylinkagemapandfinemappingofqtlforgrowthinasianseabass
AT yebaoqing constructionofahighdensitylinkagemapandfinemappingofqtlforgrowthinasianseabass
AT yuegenhua constructionofahighdensitylinkagemapandfinemappingofqtlforgrowthinasianseabass