Cargando…
Construction of a high-density linkage map and fine mapping of QTL for growth in Asian seabass
A high-density genetic map is essential for comparative genomic studies and fine mapping of QTL, and can also facilitate genome sequence assembly. Here, a high density genetic map of Asian seabass was constructed with 3321 SNPs generated by sequencing 144 individuals in a F(2) family. The length of...
Autores principales: | , , , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Nature Publishing Group
2015
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4639833/ https://www.ncbi.nlm.nih.gov/pubmed/26553309 http://dx.doi.org/10.1038/srep16358 |
_version_ | 1782399994493403136 |
---|---|
author | Wang, Le Wan, Zi Yi Bai, Bin Huang, Shu Qing Chua, Elaine Lee, May Pang, Hong Yan Wen, Yan Fei Liu, Peng Liu, Feng Sun, Fei Lin, Grace Ye, Bao Qing Yue, Gen Hua |
author_facet | Wang, Le Wan, Zi Yi Bai, Bin Huang, Shu Qing Chua, Elaine Lee, May Pang, Hong Yan Wen, Yan Fei Liu, Peng Liu, Feng Sun, Fei Lin, Grace Ye, Bao Qing Yue, Gen Hua |
author_sort | Wang, Le |
collection | PubMed |
description | A high-density genetic map is essential for comparative genomic studies and fine mapping of QTL, and can also facilitate genome sequence assembly. Here, a high density genetic map of Asian seabass was constructed with 3321 SNPs generated by sequencing 144 individuals in a F(2) family. The length of the map was 1577.67 cM with an average marker interval of 0.52 cM. A high level of genomic synteny among Asian seabass, European seabass, Nile tilapia and stickleback was detected. Using this map, one genome-wide significant and five suggestive QTL for growth traits were detected in six linkage groups (i.e. LG4, LG5, LG11, LG13, LG14 and LG15). These QTL explained 10.5–16.0% of phenotypic variance. A candidate gene, ACOX1 within the significant QTL on LG5 was identified. The gene was differentially expressed between fast- and slow-growing Asian seabass. The high-density SNP-based map provides an important tool for fine mapping QTL in molecular breeding and comparative genome analysis. |
format | Online Article Text |
id | pubmed-4639833 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2015 |
publisher | Nature Publishing Group |
record_format | MEDLINE/PubMed |
spelling | pubmed-46398332015-11-16 Construction of a high-density linkage map and fine mapping of QTL for growth in Asian seabass Wang, Le Wan, Zi Yi Bai, Bin Huang, Shu Qing Chua, Elaine Lee, May Pang, Hong Yan Wen, Yan Fei Liu, Peng Liu, Feng Sun, Fei Lin, Grace Ye, Bao Qing Yue, Gen Hua Sci Rep Article A high-density genetic map is essential for comparative genomic studies and fine mapping of QTL, and can also facilitate genome sequence assembly. Here, a high density genetic map of Asian seabass was constructed with 3321 SNPs generated by sequencing 144 individuals in a F(2) family. The length of the map was 1577.67 cM with an average marker interval of 0.52 cM. A high level of genomic synteny among Asian seabass, European seabass, Nile tilapia and stickleback was detected. Using this map, one genome-wide significant and five suggestive QTL for growth traits were detected in six linkage groups (i.e. LG4, LG5, LG11, LG13, LG14 and LG15). These QTL explained 10.5–16.0% of phenotypic variance. A candidate gene, ACOX1 within the significant QTL on LG5 was identified. The gene was differentially expressed between fast- and slow-growing Asian seabass. The high-density SNP-based map provides an important tool for fine mapping QTL in molecular breeding and comparative genome analysis. Nature Publishing Group 2015-11-10 /pmc/articles/PMC4639833/ /pubmed/26553309 http://dx.doi.org/10.1038/srep16358 Text en Copyright © 2015, Macmillan Publishers Limited http://creativecommons.org/licenses/by/4.0/ This work is licensed under a Creative Commons Attribution 4.0 International License. The images or other third party material in this article are included in the article’s Creative Commons license, unless indicated otherwise in the credit line; if the material is not included under the Creative Commons license, users will need to obtain permission from the license holder to reproduce the material. To view a copy of this license, visit http://creativecommons.org/licenses/by/4.0/ |
spellingShingle | Article Wang, Le Wan, Zi Yi Bai, Bin Huang, Shu Qing Chua, Elaine Lee, May Pang, Hong Yan Wen, Yan Fei Liu, Peng Liu, Feng Sun, Fei Lin, Grace Ye, Bao Qing Yue, Gen Hua Construction of a high-density linkage map and fine mapping of QTL for growth in Asian seabass |
title | Construction of a high-density linkage map and fine mapping of QTL for growth in Asian seabass |
title_full | Construction of a high-density linkage map and fine mapping of QTL for growth in Asian seabass |
title_fullStr | Construction of a high-density linkage map and fine mapping of QTL for growth in Asian seabass |
title_full_unstemmed | Construction of a high-density linkage map and fine mapping of QTL for growth in Asian seabass |
title_short | Construction of a high-density linkage map and fine mapping of QTL for growth in Asian seabass |
title_sort | construction of a high-density linkage map and fine mapping of qtl for growth in asian seabass |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4639833/ https://www.ncbi.nlm.nih.gov/pubmed/26553309 http://dx.doi.org/10.1038/srep16358 |
work_keys_str_mv | AT wangle constructionofahighdensitylinkagemapandfinemappingofqtlforgrowthinasianseabass AT wanziyi constructionofahighdensitylinkagemapandfinemappingofqtlforgrowthinasianseabass AT baibin constructionofahighdensitylinkagemapandfinemappingofqtlforgrowthinasianseabass AT huangshuqing constructionofahighdensitylinkagemapandfinemappingofqtlforgrowthinasianseabass AT chuaelaine constructionofahighdensitylinkagemapandfinemappingofqtlforgrowthinasianseabass AT leemay constructionofahighdensitylinkagemapandfinemappingofqtlforgrowthinasianseabass AT panghongyan constructionofahighdensitylinkagemapandfinemappingofqtlforgrowthinasianseabass AT wenyanfei constructionofahighdensitylinkagemapandfinemappingofqtlforgrowthinasianseabass AT liupeng constructionofahighdensitylinkagemapandfinemappingofqtlforgrowthinasianseabass AT liufeng constructionofahighdensitylinkagemapandfinemappingofqtlforgrowthinasianseabass AT sunfei constructionofahighdensitylinkagemapandfinemappingofqtlforgrowthinasianseabass AT lingrace constructionofahighdensitylinkagemapandfinemappingofqtlforgrowthinasianseabass AT yebaoqing constructionofahighdensitylinkagemapandfinemappingofqtlforgrowthinasianseabass AT yuegenhua constructionofahighdensitylinkagemapandfinemappingofqtlforgrowthinasianseabass |