Cargando…

Osteoprotegerin Induces Apoptosis of Osteoclasts and Osteoclast Precursor Cells via the Fas/Fas Ligand Pathway

Osteoprotegerin (OPG) is known to inhibit differentiation and activation of osteoclasts (OCs) by functioning as a decoy receptor blocking interactions between RANK and RANKL. However, the exact role of OPG in the survival/apoptosis of OCs remains unclear. OPG caused increased rates of apoptosis of b...

Descripción completa

Detalles Bibliográficos
Autores principales: Liu, Wei, Xu, Chao, Zhao, Hongyan, Xia, Pengpeng, Song, Ruilong, Gu, Jianhong, Liu, Xuezhong, Bian, Jianchun, Yuan, Yan, Liu, Zongping
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Public Library of Science 2015
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4646684/
https://www.ncbi.nlm.nih.gov/pubmed/26571489
http://dx.doi.org/10.1371/journal.pone.0142519
_version_ 1782400974046887936
author Liu, Wei
Xu, Chao
Zhao, Hongyan
Xia, Pengpeng
Song, Ruilong
Gu, Jianhong
Liu, Xuezhong
Bian, Jianchun
Yuan, Yan
Liu, Zongping
author_facet Liu, Wei
Xu, Chao
Zhao, Hongyan
Xia, Pengpeng
Song, Ruilong
Gu, Jianhong
Liu, Xuezhong
Bian, Jianchun
Yuan, Yan
Liu, Zongping
author_sort Liu, Wei
collection PubMed
description Osteoprotegerin (OPG) is known to inhibit differentiation and activation of osteoclasts (OCs) by functioning as a decoy receptor blocking interactions between RANK and RANKL. However, the exact role of OPG in the survival/apoptosis of OCs remains unclear. OPG caused increased rates of apoptosis of both OCs and osteoclast precursor cells (OPCs). The expression of Fas and activated caspase-8 was increased by both 20 ng/mL and 40 ng/mL of OPG, but was markedly decreased at 80 ng/mL. Interestingly, we noted that while levels of Fas ligand (FasL) increased with increasing doses of OPG, the soluble form of FasL in the supernatant decreased. The results of a co-immunoprecipitation assay suggested that the decrease of sFasL might be caused by the binding of OPG. This would block the inhibition of the apoptosis of OCs and OPCs. Furthermore, changes in expression levels of Bax/Bcl-2, cleaved-caspase-9, cleaved-caspased-3 and the translocation of cytochrome c, illustrated that OPG induced apoptosis of OCs and OPCs via the classic Fas/FasL apoptosis pathway, and was mediated by mitochondria. Altogether, our results demonstrate that OPG induces OCs and OPCs apoptosis partly by the Fas/FasL signaling pathway.
format Online
Article
Text
id pubmed-4646684
institution National Center for Biotechnology Information
language English
publishDate 2015
publisher Public Library of Science
record_format MEDLINE/PubMed
spelling pubmed-46466842015-11-25 Osteoprotegerin Induces Apoptosis of Osteoclasts and Osteoclast Precursor Cells via the Fas/Fas Ligand Pathway Liu, Wei Xu, Chao Zhao, Hongyan Xia, Pengpeng Song, Ruilong Gu, Jianhong Liu, Xuezhong Bian, Jianchun Yuan, Yan Liu, Zongping PLoS One Research Article Osteoprotegerin (OPG) is known to inhibit differentiation and activation of osteoclasts (OCs) by functioning as a decoy receptor blocking interactions between RANK and RANKL. However, the exact role of OPG in the survival/apoptosis of OCs remains unclear. OPG caused increased rates of apoptosis of both OCs and osteoclast precursor cells (OPCs). The expression of Fas and activated caspase-8 was increased by both 20 ng/mL and 40 ng/mL of OPG, but was markedly decreased at 80 ng/mL. Interestingly, we noted that while levels of Fas ligand (FasL) increased with increasing doses of OPG, the soluble form of FasL in the supernatant decreased. The results of a co-immunoprecipitation assay suggested that the decrease of sFasL might be caused by the binding of OPG. This would block the inhibition of the apoptosis of OCs and OPCs. Furthermore, changes in expression levels of Bax/Bcl-2, cleaved-caspase-9, cleaved-caspased-3 and the translocation of cytochrome c, illustrated that OPG induced apoptosis of OCs and OPCs via the classic Fas/FasL apoptosis pathway, and was mediated by mitochondria. Altogether, our results demonstrate that OPG induces OCs and OPCs apoptosis partly by the Fas/FasL signaling pathway. Public Library of Science 2015-11-16 /pmc/articles/PMC4646684/ /pubmed/26571489 http://dx.doi.org/10.1371/journal.pone.0142519 Text en © 2015 Liu et al http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are properly credited.
spellingShingle Research Article
Liu, Wei
Xu, Chao
Zhao, Hongyan
Xia, Pengpeng
Song, Ruilong
Gu, Jianhong
Liu, Xuezhong
Bian, Jianchun
Yuan, Yan
Liu, Zongping
Osteoprotegerin Induces Apoptosis of Osteoclasts and Osteoclast Precursor Cells via the Fas/Fas Ligand Pathway
title Osteoprotegerin Induces Apoptosis of Osteoclasts and Osteoclast Precursor Cells via the Fas/Fas Ligand Pathway
title_full Osteoprotegerin Induces Apoptosis of Osteoclasts and Osteoclast Precursor Cells via the Fas/Fas Ligand Pathway
title_fullStr Osteoprotegerin Induces Apoptosis of Osteoclasts and Osteoclast Precursor Cells via the Fas/Fas Ligand Pathway
title_full_unstemmed Osteoprotegerin Induces Apoptosis of Osteoclasts and Osteoclast Precursor Cells via the Fas/Fas Ligand Pathway
title_short Osteoprotegerin Induces Apoptosis of Osteoclasts and Osteoclast Precursor Cells via the Fas/Fas Ligand Pathway
title_sort osteoprotegerin induces apoptosis of osteoclasts and osteoclast precursor cells via the fas/fas ligand pathway
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4646684/
https://www.ncbi.nlm.nih.gov/pubmed/26571489
http://dx.doi.org/10.1371/journal.pone.0142519
work_keys_str_mv AT liuwei osteoprotegerininducesapoptosisofosteoclastsandosteoclastprecursorcellsviathefasfasligandpathway
AT xuchao osteoprotegerininducesapoptosisofosteoclastsandosteoclastprecursorcellsviathefasfasligandpathway
AT zhaohongyan osteoprotegerininducesapoptosisofosteoclastsandosteoclastprecursorcellsviathefasfasligandpathway
AT xiapengpeng osteoprotegerininducesapoptosisofosteoclastsandosteoclastprecursorcellsviathefasfasligandpathway
AT songruilong osteoprotegerininducesapoptosisofosteoclastsandosteoclastprecursorcellsviathefasfasligandpathway
AT gujianhong osteoprotegerininducesapoptosisofosteoclastsandosteoclastprecursorcellsviathefasfasligandpathway
AT liuxuezhong osteoprotegerininducesapoptosisofosteoclastsandosteoclastprecursorcellsviathefasfasligandpathway
AT bianjianchun osteoprotegerininducesapoptosisofosteoclastsandosteoclastprecursorcellsviathefasfasligandpathway
AT yuanyan osteoprotegerininducesapoptosisofosteoclastsandosteoclastprecursorcellsviathefasfasligandpathway
AT liuzongping osteoprotegerininducesapoptosisofosteoclastsandosteoclastprecursorcellsviathefasfasligandpathway