Cargando…
Osteoprotegerin Induces Apoptosis of Osteoclasts and Osteoclast Precursor Cells via the Fas/Fas Ligand Pathway
Osteoprotegerin (OPG) is known to inhibit differentiation and activation of osteoclasts (OCs) by functioning as a decoy receptor blocking interactions between RANK and RANKL. However, the exact role of OPG in the survival/apoptosis of OCs remains unclear. OPG caused increased rates of apoptosis of b...
Autores principales: | , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Public Library of Science
2015
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4646684/ https://www.ncbi.nlm.nih.gov/pubmed/26571489 http://dx.doi.org/10.1371/journal.pone.0142519 |
_version_ | 1782400974046887936 |
---|---|
author | Liu, Wei Xu, Chao Zhao, Hongyan Xia, Pengpeng Song, Ruilong Gu, Jianhong Liu, Xuezhong Bian, Jianchun Yuan, Yan Liu, Zongping |
author_facet | Liu, Wei Xu, Chao Zhao, Hongyan Xia, Pengpeng Song, Ruilong Gu, Jianhong Liu, Xuezhong Bian, Jianchun Yuan, Yan Liu, Zongping |
author_sort | Liu, Wei |
collection | PubMed |
description | Osteoprotegerin (OPG) is known to inhibit differentiation and activation of osteoclasts (OCs) by functioning as a decoy receptor blocking interactions between RANK and RANKL. However, the exact role of OPG in the survival/apoptosis of OCs remains unclear. OPG caused increased rates of apoptosis of both OCs and osteoclast precursor cells (OPCs). The expression of Fas and activated caspase-8 was increased by both 20 ng/mL and 40 ng/mL of OPG, but was markedly decreased at 80 ng/mL. Interestingly, we noted that while levels of Fas ligand (FasL) increased with increasing doses of OPG, the soluble form of FasL in the supernatant decreased. The results of a co-immunoprecipitation assay suggested that the decrease of sFasL might be caused by the binding of OPG. This would block the inhibition of the apoptosis of OCs and OPCs. Furthermore, changes in expression levels of Bax/Bcl-2, cleaved-caspase-9, cleaved-caspased-3 and the translocation of cytochrome c, illustrated that OPG induced apoptosis of OCs and OPCs via the classic Fas/FasL apoptosis pathway, and was mediated by mitochondria. Altogether, our results demonstrate that OPG induces OCs and OPCs apoptosis partly by the Fas/FasL signaling pathway. |
format | Online Article Text |
id | pubmed-4646684 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2015 |
publisher | Public Library of Science |
record_format | MEDLINE/PubMed |
spelling | pubmed-46466842015-11-25 Osteoprotegerin Induces Apoptosis of Osteoclasts and Osteoclast Precursor Cells via the Fas/Fas Ligand Pathway Liu, Wei Xu, Chao Zhao, Hongyan Xia, Pengpeng Song, Ruilong Gu, Jianhong Liu, Xuezhong Bian, Jianchun Yuan, Yan Liu, Zongping PLoS One Research Article Osteoprotegerin (OPG) is known to inhibit differentiation and activation of osteoclasts (OCs) by functioning as a decoy receptor blocking interactions between RANK and RANKL. However, the exact role of OPG in the survival/apoptosis of OCs remains unclear. OPG caused increased rates of apoptosis of both OCs and osteoclast precursor cells (OPCs). The expression of Fas and activated caspase-8 was increased by both 20 ng/mL and 40 ng/mL of OPG, but was markedly decreased at 80 ng/mL. Interestingly, we noted that while levels of Fas ligand (FasL) increased with increasing doses of OPG, the soluble form of FasL in the supernatant decreased. The results of a co-immunoprecipitation assay suggested that the decrease of sFasL might be caused by the binding of OPG. This would block the inhibition of the apoptosis of OCs and OPCs. Furthermore, changes in expression levels of Bax/Bcl-2, cleaved-caspase-9, cleaved-caspased-3 and the translocation of cytochrome c, illustrated that OPG induced apoptosis of OCs and OPCs via the classic Fas/FasL apoptosis pathway, and was mediated by mitochondria. Altogether, our results demonstrate that OPG induces OCs and OPCs apoptosis partly by the Fas/FasL signaling pathway. Public Library of Science 2015-11-16 /pmc/articles/PMC4646684/ /pubmed/26571489 http://dx.doi.org/10.1371/journal.pone.0142519 Text en © 2015 Liu et al http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are properly credited. |
spellingShingle | Research Article Liu, Wei Xu, Chao Zhao, Hongyan Xia, Pengpeng Song, Ruilong Gu, Jianhong Liu, Xuezhong Bian, Jianchun Yuan, Yan Liu, Zongping Osteoprotegerin Induces Apoptosis of Osteoclasts and Osteoclast Precursor Cells via the Fas/Fas Ligand Pathway |
title | Osteoprotegerin Induces Apoptosis of Osteoclasts and Osteoclast Precursor Cells via the Fas/Fas Ligand Pathway |
title_full | Osteoprotegerin Induces Apoptosis of Osteoclasts and Osteoclast Precursor Cells via the Fas/Fas Ligand Pathway |
title_fullStr | Osteoprotegerin Induces Apoptosis of Osteoclasts and Osteoclast Precursor Cells via the Fas/Fas Ligand Pathway |
title_full_unstemmed | Osteoprotegerin Induces Apoptosis of Osteoclasts and Osteoclast Precursor Cells via the Fas/Fas Ligand Pathway |
title_short | Osteoprotegerin Induces Apoptosis of Osteoclasts and Osteoclast Precursor Cells via the Fas/Fas Ligand Pathway |
title_sort | osteoprotegerin induces apoptosis of osteoclasts and osteoclast precursor cells via the fas/fas ligand pathway |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4646684/ https://www.ncbi.nlm.nih.gov/pubmed/26571489 http://dx.doi.org/10.1371/journal.pone.0142519 |
work_keys_str_mv | AT liuwei osteoprotegerininducesapoptosisofosteoclastsandosteoclastprecursorcellsviathefasfasligandpathway AT xuchao osteoprotegerininducesapoptosisofosteoclastsandosteoclastprecursorcellsviathefasfasligandpathway AT zhaohongyan osteoprotegerininducesapoptosisofosteoclastsandosteoclastprecursorcellsviathefasfasligandpathway AT xiapengpeng osteoprotegerininducesapoptosisofosteoclastsandosteoclastprecursorcellsviathefasfasligandpathway AT songruilong osteoprotegerininducesapoptosisofosteoclastsandosteoclastprecursorcellsviathefasfasligandpathway AT gujianhong osteoprotegerininducesapoptosisofosteoclastsandosteoclastprecursorcellsviathefasfasligandpathway AT liuxuezhong osteoprotegerininducesapoptosisofosteoclastsandosteoclastprecursorcellsviathefasfasligandpathway AT bianjianchun osteoprotegerininducesapoptosisofosteoclastsandosteoclastprecursorcellsviathefasfasligandpathway AT yuanyan osteoprotegerininducesapoptosisofosteoclastsandosteoclastprecursorcellsviathefasfasligandpathway AT liuzongping osteoprotegerininducesapoptosisofosteoclastsandosteoclastprecursorcellsviathefasfasligandpathway |