Cargando…
Etiologies of conjugated hyperbilirubinemia in infancy: a systematic review of 1692 subjects
BACKGROUND: The etiologies of conjugated hyperbilirubinemia in infancy are diverse. OBJECTIVE: Determine the prevalence rates of the specific etiologies of conjugated hyperbilirubinemia in infancy. DATA SOURCES: EMBASE and Pubmed were searched electronically and the bibliographies of selected studie...
Autores principales: | , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2015
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4654877/ https://www.ncbi.nlm.nih.gov/pubmed/26589959 http://dx.doi.org/10.1186/s12887-015-0506-5 |
_version_ | 1782402116988436480 |
---|---|
author | Gottesman, Lena E. Del Vecchio, Michael T. Aronoff, Stephen C. |
author_facet | Gottesman, Lena E. Del Vecchio, Michael T. Aronoff, Stephen C. |
author_sort | Gottesman, Lena E. |
collection | PubMed |
description | BACKGROUND: The etiologies of conjugated hyperbilirubinemia in infancy are diverse. OBJECTIVE: Determine the prevalence rates of the specific etiologies of conjugated hyperbilirubinemia in infancy. DATA SOURCES: EMBASE and Pubmed were searched electronically and the bibliographies of selected studies were search manually. The search was conducted independently by two authors. STUDY SELECTION: (1) prospective or retrospective case series or cohort study with 10 or more subjects; (2) consecutive infants who presented with conjugated hyperbilirubinemia; (3) subjects underwent appropriate diagnostic work-up for conjugated hyperbilirubinemia; (4) no specific diagnoses were excluded in the studied cohort. DATA EXTRACTION: Patient number, age range, country of origin, and categorical and specific etiologies. RESULTS: From 237 studies identified, 17 studies encompassing 1692 infants were selected. Idiopathic neonatal hepatitis (INH) occurred in 26.0 % of cases; the most common specific etiologies were extrahepatic biliary atresia (EHBA) (25.89 %), infection (11.47 %), TPN- associated cholestasis (6.44 %), metabolic disease (4.37 %), alpha-1 anti-trypsin deficiency (4.14 %), and perinatal hypoxia/ischemia (3.66 %). CMV was the most common infection identified (31.51 %) and galactosemia (36.49 %) was the most common metabolic disease identified. LIMITATIONS: Major limitations are: (1) inconsistencies in the diagnostic evaluations among the different studies and (2) variations among the sample populations. CONCLUSIONS: INH is the most common diagnosis for conjugated hyperbilirubinemia in infancy while EHBA and infection are the most commonly identified etiologies. The present review is intended to be a guide to the differential diagnosis and evaluation of the infant presenting with conjugated hyperbilirubinemia. |
format | Online Article Text |
id | pubmed-4654877 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2015 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-46548772015-11-22 Etiologies of conjugated hyperbilirubinemia in infancy: a systematic review of 1692 subjects Gottesman, Lena E. Del Vecchio, Michael T. Aronoff, Stephen C. BMC Pediatr Research Article BACKGROUND: The etiologies of conjugated hyperbilirubinemia in infancy are diverse. OBJECTIVE: Determine the prevalence rates of the specific etiologies of conjugated hyperbilirubinemia in infancy. DATA SOURCES: EMBASE and Pubmed were searched electronically and the bibliographies of selected studies were search manually. The search was conducted independently by two authors. STUDY SELECTION: (1) prospective or retrospective case series or cohort study with 10 or more subjects; (2) consecutive infants who presented with conjugated hyperbilirubinemia; (3) subjects underwent appropriate diagnostic work-up for conjugated hyperbilirubinemia; (4) no specific diagnoses were excluded in the studied cohort. DATA EXTRACTION: Patient number, age range, country of origin, and categorical and specific etiologies. RESULTS: From 237 studies identified, 17 studies encompassing 1692 infants were selected. Idiopathic neonatal hepatitis (INH) occurred in 26.0 % of cases; the most common specific etiologies were extrahepatic biliary atresia (EHBA) (25.89 %), infection (11.47 %), TPN- associated cholestasis (6.44 %), metabolic disease (4.37 %), alpha-1 anti-trypsin deficiency (4.14 %), and perinatal hypoxia/ischemia (3.66 %). CMV was the most common infection identified (31.51 %) and galactosemia (36.49 %) was the most common metabolic disease identified. LIMITATIONS: Major limitations are: (1) inconsistencies in the diagnostic evaluations among the different studies and (2) variations among the sample populations. CONCLUSIONS: INH is the most common diagnosis for conjugated hyperbilirubinemia in infancy while EHBA and infection are the most commonly identified etiologies. The present review is intended to be a guide to the differential diagnosis and evaluation of the infant presenting with conjugated hyperbilirubinemia. BioMed Central 2015-11-20 /pmc/articles/PMC4654877/ /pubmed/26589959 http://dx.doi.org/10.1186/s12887-015-0506-5 Text en © Gottesman et al. 2015 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Research Article Gottesman, Lena E. Del Vecchio, Michael T. Aronoff, Stephen C. Etiologies of conjugated hyperbilirubinemia in infancy: a systematic review of 1692 subjects |
title | Etiologies of conjugated hyperbilirubinemia in infancy: a systematic review of 1692 subjects |
title_full | Etiologies of conjugated hyperbilirubinemia in infancy: a systematic review of 1692 subjects |
title_fullStr | Etiologies of conjugated hyperbilirubinemia in infancy: a systematic review of 1692 subjects |
title_full_unstemmed | Etiologies of conjugated hyperbilirubinemia in infancy: a systematic review of 1692 subjects |
title_short | Etiologies of conjugated hyperbilirubinemia in infancy: a systematic review of 1692 subjects |
title_sort | etiologies of conjugated hyperbilirubinemia in infancy: a systematic review of 1692 subjects |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4654877/ https://www.ncbi.nlm.nih.gov/pubmed/26589959 http://dx.doi.org/10.1186/s12887-015-0506-5 |
work_keys_str_mv | AT gottesmanlenae etiologiesofconjugatedhyperbilirubinemiaininfancyasystematicreviewof1692subjects AT delvecchiomichaelt etiologiesofconjugatedhyperbilirubinemiaininfancyasystematicreviewof1692subjects AT aronoffstephenc etiologiesofconjugatedhyperbilirubinemiaininfancyasystematicreviewof1692subjects |