Cargando…
Telemedicine for general practice: a systematic review protocol
BACKGROUND: The use of information technology in healthcare is fast becoming an alternative and supporting method of providing many forms of services in a healthcare and health management setting. Telephone technology is used readily to deliver services such as disease management, consultations and...
Autores principales: | , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2015
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4657341/ https://www.ncbi.nlm.nih.gov/pubmed/26597992 http://dx.doi.org/10.1186/s13643-015-0115-2 |
_version_ | 1782402380321521664 |
---|---|
author | Downes, Martin J. Mervin, Merehau C. Byrnes, Joshua M. Scuffham, Paul A. |
author_facet | Downes, Martin J. Mervin, Merehau C. Byrnes, Joshua M. Scuffham, Paul A. |
author_sort | Downes, Martin J. |
collection | PubMed |
description | BACKGROUND: The use of information technology in healthcare is fast becoming an alternative and supporting method of providing many forms of services in a healthcare and health management setting. Telephone technology is used readily to deliver services such as disease management, consultations and behaviour coaching. Telemedicine provides a promising alternative and supporting service for face-to-face general practice care. The aim of this review is to utilise a systematic review to collate evidence on the use of telemedicine as a lead in and an alternative to general practice visits. METHODS/DESIGN: A systematic search of MEDLINE, CINAHL, the Cochrane Library and the International Clinical Trials Registry Platform will be performed using the search terms for the intervention (telemedicine) and the comparator (general practice) to search the databases. The systematic review aims to identify randomised control trials; however, if none are identified, an updated search will be conducted to identify lower levels of evidence. Papers will be reviewed and assessed for quality and data extracted using two reviewers; if consensus is required, a third reviewer will be consulted. If applicable, a meta-analysis of relevant outcomes will be conducted. The protocol has been reported according to the Preferred Reporting Items for Systematic Reviews and Meta-Analyses protocols (PRISMA-P) guidelines. DISCUSSION: The intervention and comparator have the potential to provide a vast range of healthcare services to a range of diseases and health conditions. There is likely to be difficulty in identifying relevant clinical outcome measures for the patient population. A range of outcome measures will therefore be collected in the data extraction phase. SYSTEMATIC REVIEW REGISTRATION: PROSPERO CRD42015025225 ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s13643-015-0115-2) contains supplementary material, which is available to authorized users. |
format | Online Article Text |
id | pubmed-4657341 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2015 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-46573412015-11-25 Telemedicine for general practice: a systematic review protocol Downes, Martin J. Mervin, Merehau C. Byrnes, Joshua M. Scuffham, Paul A. Syst Rev Protocol BACKGROUND: The use of information technology in healthcare is fast becoming an alternative and supporting method of providing many forms of services in a healthcare and health management setting. Telephone technology is used readily to deliver services such as disease management, consultations and behaviour coaching. Telemedicine provides a promising alternative and supporting service for face-to-face general practice care. The aim of this review is to utilise a systematic review to collate evidence on the use of telemedicine as a lead in and an alternative to general practice visits. METHODS/DESIGN: A systematic search of MEDLINE, CINAHL, the Cochrane Library and the International Clinical Trials Registry Platform will be performed using the search terms for the intervention (telemedicine) and the comparator (general practice) to search the databases. The systematic review aims to identify randomised control trials; however, if none are identified, an updated search will be conducted to identify lower levels of evidence. Papers will be reviewed and assessed for quality and data extracted using two reviewers; if consensus is required, a third reviewer will be consulted. If applicable, a meta-analysis of relevant outcomes will be conducted. The protocol has been reported according to the Preferred Reporting Items for Systematic Reviews and Meta-Analyses protocols (PRISMA-P) guidelines. DISCUSSION: The intervention and comparator have the potential to provide a vast range of healthcare services to a range of diseases and health conditions. There is likely to be difficulty in identifying relevant clinical outcome measures for the patient population. A range of outcome measures will therefore be collected in the data extraction phase. SYSTEMATIC REVIEW REGISTRATION: PROSPERO CRD42015025225 ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s13643-015-0115-2) contains supplementary material, which is available to authorized users. BioMed Central 2015-10-05 /pmc/articles/PMC4657341/ /pubmed/26597992 http://dx.doi.org/10.1186/s13643-015-0115-2 Text en © Downes et al. 2015 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Protocol Downes, Martin J. Mervin, Merehau C. Byrnes, Joshua M. Scuffham, Paul A. Telemedicine for general practice: a systematic review protocol |
title | Telemedicine for general practice: a systematic review protocol |
title_full | Telemedicine for general practice: a systematic review protocol |
title_fullStr | Telemedicine for general practice: a systematic review protocol |
title_full_unstemmed | Telemedicine for general practice: a systematic review protocol |
title_short | Telemedicine for general practice: a systematic review protocol |
title_sort | telemedicine for general practice: a systematic review protocol |
topic | Protocol |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4657341/ https://www.ncbi.nlm.nih.gov/pubmed/26597992 http://dx.doi.org/10.1186/s13643-015-0115-2 |
work_keys_str_mv | AT downesmartinj telemedicineforgeneralpracticeasystematicreviewprotocol AT mervinmerehauc telemedicineforgeneralpracticeasystematicreviewprotocol AT byrnesjoshuam telemedicineforgeneralpracticeasystematicreviewprotocol AT scuffhampaula telemedicineforgeneralpracticeasystematicreviewprotocol |