Cargando…
Natriuretic Peptides in Kawasaki Disease: the Myocardial Perspective
Making a diagnosis of Kawasaki disease with certainty may be challenging, especially since the recognition of cases with incomplete diagnostic criteria and its consequences. In order to build the diagnostic case in daily practice, clinicians rely on clinical criteria established over four decades ag...
Autores principales: | , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
MDPI
2013
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4665578/ https://www.ncbi.nlm.nih.gov/pubmed/26835665 http://dx.doi.org/10.3390/diagnostics3010001 |
_version_ | 1782403600258957312 |
---|---|
author | Dahdah, Nagib Fournier, Anne |
author_facet | Dahdah, Nagib Fournier, Anne |
author_sort | Dahdah, Nagib |
collection | PubMed |
description | Making a diagnosis of Kawasaki disease with certainty may be challenging, especially since the recognition of cases with incomplete diagnostic criteria and its consequences. In order to build the diagnostic case in daily practice, clinicians rely on clinical criteria established over four decades ago, aided by non specific laboratory tests, and above all inspired by experience. We have recently studied the diagnostic value of N-terminal pro B-type natriuretic peptide to improve the diagnostic certainty of cases with complete or incomplete clinical criteria. Our working hypothesis was based on the fact that myocarditis is present in nearly all Kawasaki disease patients supported by histology data. In this paper, we review these facts and the myocardial perspective from the diagnostic and the mechanistic standpoints. |
format | Online Article Text |
id | pubmed-4665578 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2013 |
publisher | MDPI |
record_format | MEDLINE/PubMed |
spelling | pubmed-46655782016-01-27 Natriuretic Peptides in Kawasaki Disease: the Myocardial Perspective Dahdah, Nagib Fournier, Anne Diagnostics (Basel) Review Making a diagnosis of Kawasaki disease with certainty may be challenging, especially since the recognition of cases with incomplete diagnostic criteria and its consequences. In order to build the diagnostic case in daily practice, clinicians rely on clinical criteria established over four decades ago, aided by non specific laboratory tests, and above all inspired by experience. We have recently studied the diagnostic value of N-terminal pro B-type natriuretic peptide to improve the diagnostic certainty of cases with complete or incomplete clinical criteria. Our working hypothesis was based on the fact that myocarditis is present in nearly all Kawasaki disease patients supported by histology data. In this paper, we review these facts and the myocardial perspective from the diagnostic and the mechanistic standpoints. MDPI 2013-01-10 /pmc/articles/PMC4665578/ /pubmed/26835665 http://dx.doi.org/10.3390/diagnostics3010001 Text en © 2013 by the authors; licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution license (http://creativecommons.org/licenses/by/3.0/). |
spellingShingle | Review Dahdah, Nagib Fournier, Anne Natriuretic Peptides in Kawasaki Disease: the Myocardial Perspective |
title | Natriuretic Peptides in Kawasaki Disease: the Myocardial Perspective |
title_full | Natriuretic Peptides in Kawasaki Disease: the Myocardial Perspective |
title_fullStr | Natriuretic Peptides in Kawasaki Disease: the Myocardial Perspective |
title_full_unstemmed | Natriuretic Peptides in Kawasaki Disease: the Myocardial Perspective |
title_short | Natriuretic Peptides in Kawasaki Disease: the Myocardial Perspective |
title_sort | natriuretic peptides in kawasaki disease: the myocardial perspective |
topic | Review |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4665578/ https://www.ncbi.nlm.nih.gov/pubmed/26835665 http://dx.doi.org/10.3390/diagnostics3010001 |
work_keys_str_mv | AT dahdahnagib natriureticpeptidesinkawasakidiseasethemyocardialperspective AT fournieranne natriureticpeptidesinkawasakidiseasethemyocardialperspective |