Cargando…

Natriuretic Peptides in Kawasaki Disease: the Myocardial Perspective

Making a diagnosis of Kawasaki disease with certainty may be challenging, especially since the recognition of cases with incomplete diagnostic criteria and its consequences. In order to build the diagnostic case in daily practice, clinicians rely on clinical criteria established over four decades ag...

Descripción completa

Detalles Bibliográficos
Autores principales: Dahdah, Nagib, Fournier, Anne
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2013
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4665578/
https://www.ncbi.nlm.nih.gov/pubmed/26835665
http://dx.doi.org/10.3390/diagnostics3010001
_version_ 1782403600258957312
author Dahdah, Nagib
Fournier, Anne
author_facet Dahdah, Nagib
Fournier, Anne
author_sort Dahdah, Nagib
collection PubMed
description Making a diagnosis of Kawasaki disease with certainty may be challenging, especially since the recognition of cases with incomplete diagnostic criteria and its consequences. In order to build the diagnostic case in daily practice, clinicians rely on clinical criteria established over four decades ago, aided by non specific laboratory tests, and above all inspired by experience. We have recently studied the diagnostic value of N-terminal pro B-type natriuretic peptide to improve the diagnostic certainty of cases with complete or incomplete clinical criteria. Our working hypothesis was based on the fact that myocarditis is present in nearly all Kawasaki disease patients supported by histology data. In this paper, we review these facts and the myocardial perspective from the diagnostic and the mechanistic standpoints.
format Online
Article
Text
id pubmed-4665578
institution National Center for Biotechnology Information
language English
publishDate 2013
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-46655782016-01-27 Natriuretic Peptides in Kawasaki Disease: the Myocardial Perspective Dahdah, Nagib Fournier, Anne Diagnostics (Basel) Review Making a diagnosis of Kawasaki disease with certainty may be challenging, especially since the recognition of cases with incomplete diagnostic criteria and its consequences. In order to build the diagnostic case in daily practice, clinicians rely on clinical criteria established over four decades ago, aided by non specific laboratory tests, and above all inspired by experience. We have recently studied the diagnostic value of N-terminal pro B-type natriuretic peptide to improve the diagnostic certainty of cases with complete or incomplete clinical criteria. Our working hypothesis was based on the fact that myocarditis is present in nearly all Kawasaki disease patients supported by histology data. In this paper, we review these facts and the myocardial perspective from the diagnostic and the mechanistic standpoints. MDPI 2013-01-10 /pmc/articles/PMC4665578/ /pubmed/26835665 http://dx.doi.org/10.3390/diagnostics3010001 Text en © 2013 by the authors; licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution license (http://creativecommons.org/licenses/by/3.0/).
spellingShingle Review
Dahdah, Nagib
Fournier, Anne
Natriuretic Peptides in Kawasaki Disease: the Myocardial Perspective
title Natriuretic Peptides in Kawasaki Disease: the Myocardial Perspective
title_full Natriuretic Peptides in Kawasaki Disease: the Myocardial Perspective
title_fullStr Natriuretic Peptides in Kawasaki Disease: the Myocardial Perspective
title_full_unstemmed Natriuretic Peptides in Kawasaki Disease: the Myocardial Perspective
title_short Natriuretic Peptides in Kawasaki Disease: the Myocardial Perspective
title_sort natriuretic peptides in kawasaki disease: the myocardial perspective
topic Review
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4665578/
https://www.ncbi.nlm.nih.gov/pubmed/26835665
http://dx.doi.org/10.3390/diagnostics3010001
work_keys_str_mv AT dahdahnagib natriureticpeptidesinkawasakidiseasethemyocardialperspective
AT fournieranne natriureticpeptidesinkawasakidiseasethemyocardialperspective